BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120137.Seq (728 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK130765-1|BAC85424.1| 154|Homo sapiens protein ( Homo sapiens ... 32 1.8 AB209221-1|BAD92458.1| 558|Homo sapiens Hypothetical protein FL... 30 9.8 >AK130765-1|BAC85424.1| 154|Homo sapiens protein ( Homo sapiens cDNA FLJ27255 fis, clone SYN09519. ). Length = 154 Score = 32.3 bits (70), Expect = 1.8 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = -1 Query: 536 YKSL*YLYLCNLLFRNYAIRTMYLLKIKFDLTFNILHIDNI 414 Y L +L+LCNL+ + Y R++Y++K+ NIL +NI Sbjct: 75 YIWLKFLFLCNLVMQ-YTWRSIYIIKLLIHFISNILLTENI 114 >AB209221-1|BAD92458.1| 558|Homo sapiens Hypothetical protein FLJ41407 variant protein. Length = 558 Score = 29.9 bits (64), Expect = 9.8 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +1 Query: 100 PACGIRTPGQSHRLIRIH-RSCYP 168 P CG R+P SHR ++H R C P Sbjct: 421 PDCGPRSPSPSHRFYKLHERRCEP 444 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,993,032 Number of Sequences: 237096 Number of extensions: 1837488 Number of successful extensions: 2750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2750 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8623170556 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -