BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120134.Seq (787 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0195 + 1327071-1327187,1328060-1328203,1328340-1328431,132... 31 0.79 09_01_0150 - 2244757-2245303,2252925-2253277 29 4.2 01_07_0229 + 42161770-42164562 29 4.2 11_01_0518 + 4057428-4057538,4059609-4059801,4059921-4060025,406... 28 7.3 03_01_0222 - 1756769-1756801,1756889-1756917,1756975-1757859,175... 28 7.3 04_04_1258 + 32165918-32166041,32167218-32167384,32167569-321677... 28 9.7 >02_01_0195 + 1327071-1327187,1328060-1328203,1328340-1328431, 1329393-1329579,1329676-1329831,1329959-1330012 Length = 249 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/63 (25%), Positives = 31/63 (49%) Frame = +3 Query: 489 LAGIARKGCVLVLWSYGSRDHVAHSMRDADLEGYFDIIISEGSTVREERSDLVQNSHNAI 668 L G+ G ++LW + HS E YF ++I G V + + ++++ +H+ Sbjct: 149 LGGLLSSGLSILLWLQFAASIFGHSTGSFMFEVYFGLLIFLGYMVYDTQ-EIIERAHHGD 207 Query: 669 VDY 677 +DY Sbjct: 208 MDY 210 >09_01_0150 - 2244757-2245303,2252925-2253277 Length = 299 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 298 VLSNKPPMYSFLKEWFLLP 354 V + PP Y+FLKE FLLP Sbjct: 4 VQRSTPPFYNFLKEGFLLP 22 >01_07_0229 + 42161770-42164562 Length = 930 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +2 Query: 35 CLRLNDAIIKRHVLVLSEYADLKYLGFEKYKFFEYVIFQFCNDPHLCKI 181 CL+LN +IK + + + LKYL F E + + P+L K+ Sbjct: 556 CLKLNQTLIKSLPVAIGQLTKLKYLNLSYMDFLEKIPYGVI--PNLSKL 602 >11_01_0518 + 4057428-4057538,4059609-4059801,4059921-4060025, 4060259-4060347,4060424-4060576,4060754-4060888, 4061241-4061407,4062129-4062223,4062367-4062740, 4062903-4063176,4063806-4063822 Length = 570 Score = 28.3 bits (60), Expect = 7.3 Identities = 22/79 (27%), Positives = 36/79 (45%) Frame = -2 Query: 552 HDLYCHTTTRLKRNPFVQFLQAVIHKRISNLNLLLFGYESAVQIEHDHVRKSPRQRFAFE 373 H LY H +K N +IH ++ + L E+ +++ + K + AF Sbjct: 150 HYLYTHKNIVVKYNG-----NRIIHVNLTQESPKLL--EAGKKLDMTYSVKWVQTNVAFA 202 Query: 372 RDHFVVWQQKPFFKKRIHW 316 R F V+ PFF+ +IHW Sbjct: 203 R-RFEVYLDYPFFEHQIHW 220 >03_01_0222 - 1756769-1756801,1756889-1756917,1756975-1757859, 1758244-1759273,1759354-1759401,1759626-1760480 Length = 959 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 17 LQSKWICLRLNDAIIKRHVLVLSEYADLKYLGFE 118 LQ W RL + I+KR + + DLKYL E Sbjct: 860 LQPSWGFQRLKEEIVKRFGISQDTHVDLKYLDDE 893 >04_04_1258 + 32165918-32166041,32167218-32167384,32167569-32167769, 32168472-32168631,32168729-32168942,32169160-32169307 Length = 337 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 68 HVLVLSEYADLKYLGFEKYKFFEYVIFQFCNDPHLCKIIENNYNYCMQIF 217 HVL ++D++YL EK + Y + + + CK+ E N + +F Sbjct: 143 HVLDEDSWSDVEYLTKEKPPAWAYSVSKVLMEKAACKLAEENNISLITVF 192 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,406,305 Number of Sequences: 37544 Number of extensions: 445580 Number of successful extensions: 999 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 999 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -