BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120132.Seq (763 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) 32 0.58 SB_51895| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 >SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) Length = 2996 Score = 31.9 bits (69), Expect = 0.58 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 640 SVGNFILTKIKGDLFDGYDYYFP 572 S+ FI+ D+F GYDYYFP Sbjct: 2126 SLSPFIIVVFLADVFGGYDYYFP 2148 >SB_51895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1368 Score = 29.5 bits (63), Expect = 3.1 Identities = 21/82 (25%), Positives = 31/82 (37%), Gaps = 3/82 (3%) Frame = +2 Query: 101 TEWMAEDGTHAQICLSPVSFLSRQSNFDKIERKYVVRGGNHDDPHAKRYPISTYHTCYLI 280 T+ A D H I + +++Q+ +D + H H K TYHT Sbjct: 1254 TQHTASDTKHTTIDTQQTTSVTQQATYDTY---HTANDNKHSTSHTKHLTNDTYHTASDT 1310 Query: 281 IHPTIFSKNL---LKQTTLDTK 337 H +K+ K T DTK Sbjct: 1311 KHTASDTKHTASDTKHTASDTK 1332 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,354,275 Number of Sequences: 59808 Number of extensions: 524987 Number of successful extensions: 1309 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1295 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -