BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120131X.Seq (378 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75537-6|CAA99838.2| 348|Caenorhabditis elegans Hypothetical pr... 27 3.4 Z75527-9|CAA99780.2| 348|Caenorhabditis elegans Hypothetical pr... 27 3.4 AY008135-1|AAG32088.1| 348|Caenorhabditis elegans heterotrimeri... 27 3.4 >Z75537-6|CAA99838.2| 348|Caenorhabditis elegans Hypothetical protein F18E2.5 protein. Length = 348 Score = 27.5 bits (58), Expect = 3.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 196 WCVYILRQDNGKLYTGITSNLTDA*NSIRTNKAPSVFATQPIY 324 +C+ I D +T+ L DA N +++ FAT PIY Sbjct: 224 FCIAISEYDQVMSEDMVTNRLDDALNLLQSISEDPAFATTPIY 266 >Z75527-9|CAA99780.2| 348|Caenorhabditis elegans Hypothetical protein F18E2.5 protein. Length = 348 Score = 27.5 bits (58), Expect = 3.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 196 WCVYILRQDNGKLYTGITSNLTDA*NSIRTNKAPSVFATQPIY 324 +C+ I D +T+ L DA N +++ FAT PIY Sbjct: 224 FCIAISEYDQVMSEDMVTNRLDDALNLLQSISEDPAFATTPIY 266 >AY008135-1|AAG32088.1| 348|Caenorhabditis elegans heterotrimeric G protein alphasubunit protein. Length = 348 Score = 27.5 bits (58), Expect = 3.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 196 WCVYILRQDNGKLYTGITSNLTDA*NSIRTNKAPSVFATQPIY 324 +C+ I D +T+ L DA N +++ FAT PIY Sbjct: 224 FCIAISEYDQVMSEDMVTNRLDDALNLLQSISEDPAFATTPIY 266 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,672,173 Number of Sequences: 27780 Number of extensions: 165694 Number of successful extensions: 523 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 557037416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -