BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120126.Seq (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 31 0.052 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 30.7 bits (66), Expect = 0.052 Identities = 26/85 (30%), Positives = 34/85 (40%) Frame = -3 Query: 516 KRLLISET*YVLMNS*SRAASTSVIEPTLYTSHINR*IISKVLCCSLLFSNNSCLPNLMK 337 K LLI T +V +N S + L T H N I CC L F N + ++ Sbjct: 373 KMLLIVSTVFVCLNLPSYIVRVKIY---LETEHTNMNIYLVQNCCQLFFMTNFGINFILY 429 Query: 336 AVCFFKF*KASTFLFEKMQDYNHNL 262 V F KA +F+K NL Sbjct: 430 CVSGQNFRKAIFGMFQKRSQRQINL 454 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 771,492 Number of Sequences: 2352 Number of extensions: 14411 Number of successful extensions: 15 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -