BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120125.Seq (707 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 5.4 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 23 7.1 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 607 RLCLTQW*NNIELYSSMKPTNGHLQQIS*WVFS 705 RLCL Q NNI + S++ N +Q++ ++++ Sbjct: 134 RLCLPQIFNNILMDFSVEQINRSIQELMIYLYN 166 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 23.4 bits (48), Expect = 7.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 624 MVEQYRVILLDEAHERTLATDILM 695 MV YR++ D HE L TD+++ Sbjct: 156 MVSFYRILPGDTMHEIRLKTDLVL 179 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,033 Number of Sequences: 2352 Number of extensions: 16003 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -