BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120122.Seq (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 6.2 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 22 6.2 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 513 GLVVAKTLFAVTAPTVD*LFAHLALLPDTPHE 418 G+V+ +V +P+V ++ P TPHE Sbjct: 698 GMVLPSPSTSVASPSVSVASPYMLQSPLTPHE 729 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 513 GLVVAKTLFAVTAPTVD*LFAHLALLPDTPHE 418 G+V+ +V +P+V ++ P TPHE Sbjct: 590 GMVLPSPSTSVASPSVSVASPYMLQSPLTPHE 621 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 618 SK*KRRIATICCTCGTQSDCYSAVSPTLC 532 S+ K +A + T CY+ ++P LC Sbjct: 59 SETKSIVAMVMGTIVNAFSCYTVLAPVLC 87 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 675 LDAEGNPINVTVDTALHRDGVLTDALNVK 761 L EGNPI +T+L + LN+K Sbjct: 518 LSLEGNPITTLSNTSLLGAANQLEELNLK 546 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,185 Number of Sequences: 336 Number of extensions: 4104 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -