BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120117.Seq (792 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC926.07c |dlc2||dynein light chain Dlc2|Schizosaccharomyces p... 94 2e-20 SPCC16C4.01 |sif2|SPCC5E4.09|Sad1 interacting factor 2|Schizosac... 27 2.3 SPAC23C11.03 |||U3 snoRNP-associated protein Mpp1 |Schizosacchar... 26 7.1 SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 7.1 SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||... 26 7.1 SPAC17G6.04c |cpp1||protein farnesyltransferase beta subunit Cpp... 25 9.4 SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch... 25 9.4 >SPAC926.07c |dlc2||dynein light chain Dlc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 85 Score = 94.3 bits (224), Expect = 2e-20 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +2 Query: 92 AVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVG 253 AVIK DMSE+MQQ+A+ A QA+EKF IEKDIAAFIK+EFDKK++PTWHCIVG Sbjct: 2 AVIKAVDMSEKMQQEAIHAAVQAMEKFTIEKDIAAFIKREFDKKFSPTWHCIVG 55 Score = 61.3 bits (142), Expect = 2e-10 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 250 GSNFGSYVTHETRHFIYFYLGQVAILLFKSG 342 G NFGS+VTHE+RHFIYFYLG VA LLFKSG Sbjct: 55 GRNFGSFVTHESRHFIYFYLGTVAFLLFKSG 85 >SPCC16C4.01 |sif2|SPCC5E4.09|Sad1 interacting factor 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 446 Score = 27.5 bits (58), Expect = 2.3 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -1 Query: 441 PQPEPRMRICKGYPSDNTASAA-NKKIEVMLNGLTALKEQYSH 316 PQ EP + Y N A N+++EV+ + L+ LKEQ +H Sbjct: 307 PQLEPIYTAARSYLEINQRVALLNQRVEVIGDLLSMLKEQITH 349 >SPAC23C11.03 |||U3 snoRNP-associated protein Mpp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 25.8 bits (54), Expect = 7.1 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 53 KQKQTQDKMCDRKAVIKNADMSEEMQQDAVDCATQALEKFNIE 181 +QKQ + + RK K M+E+ + + + L K N+E Sbjct: 527 QQKQARRRRVRRKHAEKRKQMAEKRRNSGTEQVVRQLSKSNVE 569 >SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 106 Score = 25.8 bits (54), Expect = 7.1 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -2 Query: 164 RALELHSQQHLAASLRSCQHSL*LLCDHTSCL-GFVFAS 51 ++L L + QH+ L SC ++L +L H CL F++ S Sbjct: 39 KSLHLMTSQHIFKCLSSCNYALSIL--HNICLASFLYLS 75 >SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||Manual Length = 565 Score = 25.8 bits (54), Expect = 7.1 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -1 Query: 402 PSDNTASAANKKIEVMLNGLTALKEQYSHLSQVEVDEVASL 280 P+DN A+ IE +L+G+T KE+ H+ ++ ASL Sbjct: 160 PNDNLAAQYQFWIERLLHGITE-KEELQHIYKILTLTPASL 199 >SPAC17G6.04c |cpp1||protein farnesyltransferase beta subunit Cpp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 382 Score = 25.4 bits (53), Expect = 9.4 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = -1 Query: 204 LINAAMSFSMLNFSSA*VAQSTASCCISSLMSAFFMTALRSHILSWVCFC 55 L N SF + N + A+ C+SSL+ L L W+C C Sbjct: 139 LKNPDGSFRVNNEGESDARSVYAAVCVSSLVGISMDDPLFEGTLQWLCKC 188 >SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.4 bits (53), Expect = 9.4 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +2 Query: 56 QKQTQD--KMCDRKAVIKNADMSEEMQQDAVDCATQALEKF 172 +K+T + KM K ++K AD+S +Q+D + T+ LEK+ Sbjct: 521 EKKTDEPVKMRKVKKLVKVADLSVSVQEDRL--PTEVLEKY 559 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,027,051 Number of Sequences: 5004 Number of extensions: 59067 Number of successful extensions: 144 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -