BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120117.Seq (792 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.4 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 3.3 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 3.3 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 5.7 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 5.7 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 5.7 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 7.5 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 9.9 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 1.4 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +2 Query: 41 VHLSKQKQTQDKMC-DRKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFD 217 +H ++ K+T DK+C + V+ A ++ + +EK + A +KK + Sbjct: 1689 IHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEK----NEAAMKLKKRIE 1744 Query: 218 KKYNP 232 K NP Sbjct: 1745 KGANP 1749 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 542 FHLHCLFNRKFTMLDINCVLPLHLVPGAC-GVC 637 F H +FNR ++ C + ++P C G C Sbjct: 215 FPFHLMFNRDLIIVQTGCTI-TRVIPQVCSGNC 246 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 542 FHLHCLFNRKFTMLDINCVLPLHLVPGAC-GVC 637 F H +FNR ++ C + ++P C G C Sbjct: 215 FPFHLMFNRDLIIVQTGCTI-TRVIPQVCSGNC 246 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.7 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 227 NPTWHCIVGLILARM 271 NP WH I+G ++ + Sbjct: 48 NPMWHGILGFVIGML 62 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 225 TILPGIASWV*FWLVCDTRDSPLHLLL 305 +IL + SWV FWL D SP ++L Sbjct: 242 SILIVVISWVSFWLHMDA--SPPRIVL 266 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 22.2 bits (45), Expect = 5.7 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 227 NPTWHCIVGLILARM 271 NP WH I+G ++ + Sbjct: 14 NPMWHGILGFVIGML 28 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -3 Query: 163 ERLSCTVNSILLHLFAH 113 ER+ C+ NS++ H++ + Sbjct: 42 ERVYCSRNSLMTHIYTY 58 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 9.9 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 Query: 97 HKEC*HERRDAARCC*LCNSSAREI*H*KGHSCIYQER 210 HKE H + + C LC+ R + H IY R Sbjct: 390 HKEQQHFQPLNSAVCALCHKVFRTLNSLNNHKSIYHRR 427 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,206 Number of Sequences: 438 Number of extensions: 3964 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -