BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120113.Seq (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 24 5.9 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 24 5.9 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 5.9 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 134 HRHEHVLPFHNLHILNCGQCPWPQ 63 H H H LP H H + Q P PQ Sbjct: 97 HPHHHQLPHHPHHQHHPQQQPSPQ 120 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 134 HRHEHVLPFHNLHILNCGQCPWPQ 63 H H H LP H H + Q P PQ Sbjct: 97 HPHHHQLPHHPHHQHHPQQQPSPQ 120 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.8 bits (49), Expect = 5.9 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 252 LTAVHALQDAQRGGAAKLVLRTRVAPVHRVGVEPAPRRP 368 +TAV + + G K V T +A H EPAPR P Sbjct: 474 VTAVLVKYETKTGRLNKGVATTFLAEKHPNDGEPAPRVP 512 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,303 Number of Sequences: 2352 Number of extensions: 16215 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -