BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120112.Seq (843 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1442| Best HMM Match : SRCR (HMM E-Value=0) 29 6.2 SB_36289| Best HMM Match : RNA_pol_N (HMM E-Value=1.9) 28 8.2 >SB_1442| Best HMM Match : SRCR (HMM E-Value=0) Length = 2103 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 423 SLVEAVVA*TPHGFPLTLTNS--FLEVSLRCNLSSNDASPFSIICLN 289 S E V GF + LTN+ F E RC L S A+P SI+ N Sbjct: 96 SSAEGVKLLDGEGFKILLTNTSVFSETRFRCRLFSAFAAPASILLPN 142 >SB_36289| Best HMM Match : RNA_pol_N (HMM E-Value=1.9) Length = 857 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 222 PVFVQSCNRQPQSEPPLSIQFQIDQWCQESGKPL 121 PVF Q+C + L+ Q Q+ QWC E +PL Sbjct: 6 PVFHQACQK-------LAYQVQLVQWCLEKAQPL 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,528,356 Number of Sequences: 59808 Number of extensions: 557640 Number of successful extensions: 1366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1366 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -