BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120106.Seq (774 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom... 27 3.0 SPAC1782.04 |cox24||mitochondrial mRNA processing protein Cox24 ... 25 9.1 SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha... 25 9.1 >SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1692 Score = 27.1 bits (57), Expect = 3.0 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 539 VISICSANLTNQTHRCTVFLCILYGGLSANRFDRLVYRLRFDNISA 402 VIS C + N H + C+L +SA + +R V + +DN+++ Sbjct: 1008 VISACELVVNNFLHPQSSLYCVLDSDISAGKNNR-VLKFVYDNLAS 1052 >SPAC1782.04 |cox24||mitochondrial mRNA processing protein Cox24 |Schizosaccharomyces pombe|chr 1|||Manual Length = 175 Score = 25.4 bits (53), Expect = 9.1 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -3 Query: 229 IWHVTAAPPVNT--NKPPFSQTT-ASKQSLINANF 134 IWHV+A+P V + N P T+ S + + ANF Sbjct: 25 IWHVSASPEVGSKYNLPTVPTTSHVSYRQIAKANF 59 >SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 25.4 bits (53), Expect = 9.1 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +2 Query: 233 RRRLQKRIKCIDFDYYGLCSKKMFCNLQTN-LQKCVDQHYAELDVLTRQIYMSNPLVMLK 409 R L+ + +D + LC K + L + LQK + ELD L R++Y +P + + Sbjct: 221 RSYLEFILSNLDLECLTLCLKIIKGILTLDELQKAIKLKQTELDKLERRLYRPSPQNIFE 280 Query: 410 CYQ 418 ++ Sbjct: 281 IFE 283 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,066,211 Number of Sequences: 5004 Number of extensions: 61423 Number of successful extensions: 186 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 186 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -