BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120105.Seq (815 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 5.1 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 8.9 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 93 FNFCWRLYFLDILRLMCVPCQRQDYLCFYF 182 F+F + F+DI RL V DYL F Sbjct: 217 FSFFFMPSFVDIFRLTFVDKTASDYLINVF 246 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -2 Query: 676 INWFSHSLRYFESFRNNSTKF 614 + W +++YF NN T F Sbjct: 166 LKWVQRNIKYFSGDPNNVTIF 186 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,308 Number of Sequences: 336 Number of extensions: 4211 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -