BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120105.Seq (815 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0997 + 33676441-33676758,33678223-33678314,33678443-336785... 28 7.7 >01_06_0997 + 33676441-33676758,33678223-33678314,33678443-33678540, 33678824-33678979,33679106-33679731,33679826-33679896, 33679987-33680241,33680337-33680454,33680595-33680766, 33680854-33681395 Length = 815 Score = 28.3 bits (60), Expect = 7.7 Identities = 19/81 (23%), Positives = 37/81 (45%) Frame = -3 Query: 810 DCSYSVVKTDSRNNR*V*CVSCKYKQIDRVLLEKYIYIIRDFSSILIGFLILCDILKVSG 631 +CS + S N + V C+ + I R+ + + +I+ +S LI D+L Sbjct: 454 NCSREALNGTSINGKVVLCIELTFGPIGRIFKDVFAGVIQGGASGLIFAFYTTDVLL--- 510 Query: 630 ITPQSFGASCV*ISNKLTKEI 568 T G +CV + N++ ++ Sbjct: 511 STEDCKGIACVFVDNEIGYQV 531 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,826,367 Number of Sequences: 37544 Number of extensions: 347374 Number of successful extensions: 533 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2232933960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -