BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120105.Seq (815 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF142325-1|AAD33884.1| 103|Drosophila melanogaster male accesso... 32 1.1 AE014297-3858|AAF56513.1| 103|Drosophila melanogaster CG4986-PA... 32 1.1 >AF142325-1|AAD33884.1| 103|Drosophila melanogaster male accessory gland protein protein. Length = 103 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = -3 Query: 753 VSCKYKQIDRVLLEKYIYIIRDFSSILIGFLILCDILKVSGITP 622 +SC KQ+ R+ + +++ + + L+LC +L +G+TP Sbjct: 7 ISCYLKQLQRISIVSIHQVVKMHGTHFLILLLLCGVLGSNGVTP 50 >AE014297-3858|AAF56513.1| 103|Drosophila melanogaster CG4986-PA protein. Length = 103 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = -3 Query: 753 VSCKYKQIDRVLLEKYIYIIRDFSSILIGFLILCDILKVSGITP 622 +SC KQ+ R+ + +++ + + L+LC +L +G+TP Sbjct: 7 ISCYLKQLQRISIVSIHQVVKMHGTHFLILLLLCGVLGSNGVTP 50 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,136,892 Number of Sequences: 53049 Number of extensions: 653873 Number of successful extensions: 1141 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1141 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3839531124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -