Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120105.Seq
         (815 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g42340.1 68418.m05155 armadillo/beta-catenin repeat family pr...    28   8.5  

>At5g42340.1 68418.m05155 armadillo/beta-catenin repeat family
           protein / U-box domain-containing protein low similarity
           to immediate-early fungal elicitor protein CMPG1
           [Petroselinum crispum] GI:14582200, GI:14582198;
           contains Pfam profiles PF04564: U-box domain, PF00514:
           Armadillo/beta-catenin-like repeat
          Length = 656

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +3

Query: 603 KTHQNFVELFLKLSKYRKE*ENQLILKK--NRVLCKYIFPIIPYRFVCTCTIHIKL 764
           +T Q+ +EL  K  K +      ++ +   N+ + K    I+P+ F+C  T+ I L
Sbjct: 245 ETKQHIIELLNKFKKLQGLEATDILYQPVINKAITKSTSLILPHEFLCPITLEIML 300


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,146,992
Number of Sequences: 28952
Number of extensions: 315846
Number of successful extensions: 590
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 566
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 590
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1863090400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)