BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120103.Seq (810 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 26 0.47 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 26 0.47 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 26 0.47 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 5.8 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 5.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 7.7 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 25.8 bits (54), Expect = 0.47 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 182 IMSTIHVDYTFSYFSNFVMFIVEFSLIH 265 ++S+I +DY F F+ F F F ++H Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILH 200 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 25.8 bits (54), Expect = 0.47 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 182 IMSTIHVDYTFSYFSNFVMFIVEFSLIH 265 ++S+I +DY F F+ F F F ++H Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILH 200 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 25.8 bits (54), Expect = 0.47 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 182 IMSTIHVDYTFSYFSNFVMFIVEFSLIH 265 ++S+I +DY F F+ F F F ++H Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILH 200 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +1 Query: 58 LEKNKMYNQTILYIIYTK*IHTNNYYTCFYFTIL 159 +E+ + I+ + IH NNY Y+ I+ Sbjct: 304 IERERSREPKIISSLSNNTIHNNNYNKKLYYNII 337 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = -2 Query: 665 RDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNE 531 RD+I + +NT E+ +T + + +GN E L N+ Sbjct: 314 RDRIYEAIHTGSVINTRGERIQLTEKNGIDVLGNIMEASILSPNQ 358 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 7.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 462 FCFPLRWRFSIFRPTAHVKFGVEFVQ 539 FC W F + R V+ GV F++ Sbjct: 291 FCKAFPWHFVVDRQLELVQLGVGFMR 316 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,727 Number of Sequences: 438 Number of extensions: 4628 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -