BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120103.Seq (810 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g04670.1 68416.m00500 WRKY family transcription factor simila... 30 2.1 At2g31500.1 68415.m03848 calcium-dependent protein kinase, putat... 29 3.7 At1g49560.1 68414.m05557 myb family transcription factor contain... 29 4.8 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 6.4 At2g33050.1 68415.m04053 leucine-rich repeat family protein cont... 28 6.4 At2g30250.1 68415.m03682 WRKY family transcription factor 28 6.4 At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain... 28 8.4 At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain... 28 8.4 At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain... 28 8.4 At2g45140.1 68415.m05618 vesicle-associated membrane protein, pu... 28 8.4 >At3g04670.1 68416.m00500 WRKY family transcription factor similar to elicitor response element binding protein WRKY3 isolog GB:AAB63078 [Arabidopsis thaliana] Length = 330 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 608 FRCLYSVFLHVLKQIQFCRANHHARLQFEGAATRCFWLSKFNRIKIF 748 FR Y + +H +QI + R+N L+F+G+ + C+ S N + F Sbjct: 141 FRAPYQL-IHNHQQIAYSRSNSGVNLKFDGSGSSCYTPSVSNGSRSF 186 >At2g31500.1 68415.m03848 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 582 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -1 Query: 504 SAEKLKTAIVTESKNGTVTFPRDITKHQHLAIFSERIDDRIKLAFVL 364 S EKL+T I E V R + KH ++ F E +D+ + V+ Sbjct: 98 SKEKLRTEIDVEDVRREVEIMRCLPKHPNIVSFKEAFEDKDAVYLVM 144 >At1g49560.1 68414.m05557 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 333 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/32 (34%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -2 Query: 698 HLQTEG-ERDDLRDKIESVLKHVKKLNTNSEK 606 H+Q EG D+++ ++ H++K N+N+EK Sbjct: 226 HMQEEGLTNDEVKSHLQKYRLHIRKPNSNAEK 257 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 28.3 bits (60), Expect = 6.4 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 7/80 (8%) Frame = -2 Query: 737 CG*ILTTKSN--ALLHLQTEGERDDLRDKIESVLKHVKKLNTNSEKFMVTHETF---KND 573 CG + TK ALL+ + + + D + KIE + +KKL + ET K + Sbjct: 60 CGKVEFTKDEVLALLNERAKAGKFDTKGKIEQMTDIIKKLKVCVRWYQQVDETHVQDKEN 119 Query: 572 VGNRFEQFELRLN--ELDAK 519 + + + E R + ELDAK Sbjct: 120 LSSSLQSAEKRYSDKELDAK 139 >At2g33050.1 68415.m04053 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 800 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 487 FQFFGRLRMLSLASSSFKRN--SNCSNLLPTSFLNVS 591 F RL +LSLASSSF S+ SNL+ + LN+S Sbjct: 111 FSNLTRLEVLSLASSSFTGQVPSSISNLILLTHLNLS 147 >At2g30250.1 68415.m03682 WRKY family transcription factor Length = 393 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +1 Query: 355 LLAQNKSEFDAVVDAFR--KYGQMLVFGN 435 ++ Q S+ D ++D FR KYGQ +V GN Sbjct: 316 VVVQTISDIDVLIDGFRWRKYGQKVVKGN 344 >At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 535 TNSTPNLTCAVGRKIENRHRNGKQKWHG 452 TNST C+ G KI R+ +GK +++G Sbjct: 6 TNSTIKFLCSYGGKILPRYPDGKLRYNG 33 >At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 535 TNSTPNLTCAVGRKIENRHRNGKQKWHG 452 TNST C+ G KI R+ +GK +++G Sbjct: 6 TNSTIKFLCSYGGKILPRYPDGKLRYNG 33 >At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 535 TNSTPNLTCAVGRKIENRHRNGKQKWHG 452 TNST C+ G KI R+ +GK +++G Sbjct: 6 TNSTIKFLCSYGGKILPRYPDGKLRYNG 33 >At2g45140.1 68415.m05618 vesicle-associated membrane protein, putative / VAMP, putative similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia] Length = 239 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = -2 Query: 719 TKSNALLHLQTEGERD-DLRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFEL 543 + S L+ +Q + E DL+ K + +L+ V + K VTHE F + G+R E+ +L Sbjct: 62 SSSEVLVTMQAQKEAPADLQCKDKFLLQCVVASPGATPKD-VTHEMFSKEAGHRVEETKL 120 Query: 542 RL 537 R+ Sbjct: 121 RV 122 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,311,756 Number of Sequences: 28952 Number of extensions: 322511 Number of successful extensions: 993 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 993 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1843581600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -