BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120102.Seq (853 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5915| Best HMM Match : zf-TAZ (HMM E-Value=0.06) 31 0.90 SB_48924| Best HMM Match : 7tm_2 (HMM E-Value=1.5e-16) 31 1.2 SB_20775| Best HMM Match : Somatomedin_B (HMM E-Value=7.7e-05) 31 1.2 SB_40626| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_8610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 >SB_5915| Best HMM Match : zf-TAZ (HMM E-Value=0.06) Length = 285 Score = 31.5 bits (68), Expect = 0.90 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +2 Query: 563 AINRLFGATETIDFHPNLLVYRQSSPPVRLTGDVYVVDKNEKVFLVK 703 A++RL A+ + H N + R S P +TG+ Y+ ++++ +K Sbjct: 9 ALSRLHRASFHLTLHDNQFLGRASEQPCDVTGEYYINQPRDRIYPIK 55 >SB_48924| Best HMM Match : 7tm_2 (HMM E-Value=1.5e-16) Length = 736 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 7/47 (14%) Frame = +2 Query: 614 LLVYRQSSP-------PVRLTGDVYVVDKNEKVFLVKHVFSNTVPAY 733 +LVY +SSP RLTG YV +N +V L KHV P Y Sbjct: 13 VLVYNRSSPLSAEDEKEKRLTGVQYVTSENREVTLEKHVHLKQRPLY 59 >SB_20775| Best HMM Match : Somatomedin_B (HMM E-Value=7.7e-05) Length = 375 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 7/47 (14%) Frame = +2 Query: 614 LLVYRQSSP-------PVRLTGDVYVVDKNEKVFLVKHVFSNTVPAY 733 +LVY +SSP RLTG YV +N +V L KHV P Y Sbjct: 13 VLVYNRSSPLSAEDEKEKRLTGVQYVTSENREVTLEKHVHLKQRPLY 59 >SB_40626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +2 Query: 587 TETIDFHPNLLVYRQSSPPVRLTGDVYVVDKNEKVFLVKHVFSNTVP 727 ++ +D ++RQ+ P V+L G++ + N+K F +F +T+P Sbjct: 5 SDKLDIQQLREIWRQNGPDVKLAGEISNLLLNKKCFFELEMFLSTLP 51 >SB_8610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 404 VYRVAIKN-NLARHFTVHSGVFFNHKLGNYFHDR 306 +Y+ A KN N++ F + GVF+ H LG+Y DR Sbjct: 474 LYKSAAKNGNISAQFNM--GVFYEHGLGDYDVDR 505 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,650,904 Number of Sequences: 59808 Number of extensions: 514586 Number of successful extensions: 1339 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1337 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2419355818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -