BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120101.Seq (771 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 28 0.37 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 26 1.1 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 25 2.0 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 24 6.0 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 27.9 bits (59), Expect = 0.37 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 557 RDAETARQDCENARRETAQWPTAW 628 RDA++ + CE A+R TAQ AW Sbjct: 1051 RDADSWSRICEGAKRITAQLQRAW 1074 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 557 RDAETARQDCENARRETAQWPTAW 628 RDAE+ + CE A+R TA AW Sbjct: 988 RDAESWSRICEAAKRITASLQQAW 1011 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 25.4 bits (53), Expect = 2.0 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -1 Query: 576 RAVSASRRATI-ISLANKMSDRVAPPNLRWPPSIFASDRQFWQ*HHLYPFQRPAR 415 RAV R +I I L SDRV L + + W H +YP + P R Sbjct: 182 RAVLQPNRMSIDIPLNYTASDRVTEQRLAYFREDIGVNLHHWHWHLVYPAEGPER 236 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.8 bits (49), Expect = 6.0 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = -1 Query: 558 RRATIISLANKMSDRVAPPNLRWPPSIFASDRQFWQ*HHLYPFQRPAR 415 RRA I + SDRV L + + W H +YP + P R Sbjct: 176 RRAIEIPMNFTASDRVDEQRLAYWREDIGVNLHHWHWHLVYPARGPNR 223 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 842,502 Number of Sequences: 2352 Number of extensions: 18904 Number of successful extensions: 32 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -