BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120100.Seq (827 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1415 + 37171380-37171923,37172476-37172666,37173628-37173678 29 4.5 03_05_0092 - 20714102-20717902 29 6.0 04_01_0203 + 2432745-2433642,2433723-2433806,2434458-2434471 28 7.9 >01_06_1415 + 37171380-37171923,37172476-37172666,37173628-37173678 Length = 261 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 347 KKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVKNTPELADFV 481 + I+ N Y+ +W T+ QP S W L K + A +V Sbjct: 133 RSSTISENSYLCVATWDTRAPQPSQIESAVRWALRKRSQNKAVYV 177 >03_05_0092 - 20714102-20717902 Length = 1266 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/69 (24%), Positives = 34/69 (49%) Frame = -2 Query: 454 FHQIPHGRATRPLGLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLFF 275 F + PL + L++ T N+ ++N L L H + D+H+++ I ++FF Sbjct: 571 FFMVTESSGDVPLEVRHLTIMT--NNLSKLINDLSLKISHSSG--SDQHFLQRIRTIIFF 626 Query: 274 QEIYNSNSW 248 + NS+ + Sbjct: 627 ADFSNSDEF 635 >04_01_0203 + 2432745-2433642,2433723-2433806,2434458-2434471 Length = 331 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 395 YTKIKQPEWPSSPAMWDLVKNTPELADFVFI-FDHTEK 505 + + +PEWPSS A+ N PEL V + D T K Sbjct: 169 HDQTNKPEWPSSVAVQHDQTNKPELPSSVAVQHDQTNK 206 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,579,378 Number of Sequences: 37544 Number of extensions: 449749 Number of successful extensions: 1105 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -