BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120100.Seq (827 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 29 0.23 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 26 1.6 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 26 1.6 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 25 3.8 AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismuta... 24 6.6 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 24 6.6 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 24 6.6 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 23 8.7 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 28.7 bits (61), Expect = 0.23 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 8/75 (10%) Frame = -2 Query: 445 IPHGRATRPLGLLDLSVPTVKQNVFIVV---NHLLLAFG-----HFAFVLHDRHYVEDIV 290 IP+ R RP+ L ++++P +Q F +HLLL G F L ++ +D V Sbjct: 556 IPYERTFRPMALSNINLPETEQFRFCNCGWPHHLLLPKGTAEGMKFDLFLMISNFADDTV 615 Query: 289 NVLFFQEIYNSNSWS 245 N F ++I ++S S Sbjct: 616 NQEFNEDINCNDSHS 630 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 105 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 197 A K + ++ N P+QQS+T C+N+ Sbjct: 118 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 148 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 105 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 197 A K + ++ N P+QQS+T C+N+ Sbjct: 119 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 149 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 24.6 bits (51), Expect = 3.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 611 KFALVSTAVCLFLLAGIAALSLEDDDVDRSAIFLP 507 +F + T + L +L SLED DVDR + P Sbjct: 445 RFGKLQTCLGLAMLLKSYTFSLEDCDVDRPLLIDP 479 >AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismutase 2 protein. Length = 211 Score = 23.8 bits (49), Expect = 6.6 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -2 Query: 415 GLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVED 296 G + +S P+ + VFI +N + L G F +H++ + D Sbjct: 35 GNVTISQPSCTEPVFIDINVVGLTPGKHGFHIHEKGDLTD 74 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.8 bits (49), Expect = 6.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 682 TFNNNVAPLLSSIYDEV 732 +F + + PLLSSI DEV Sbjct: 219 SFASTITPLLSSISDEV 235 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.8 bits (49), Expect = 6.6 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = +3 Query: 204 LNKLESSSYNKSNMDQLLL 260 L+ LES ++N++N ++LLL Sbjct: 293 LSTLESEAWNQANFERLLL 311 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 20 NVLSVRCVFITNELPGCWALKKYIIKN 100 +V +VRC +P A+KK++I+N Sbjct: 16 HVKAVRCTNCARCVPKDKAIKKFVIRN 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 878,759 Number of Sequences: 2352 Number of extensions: 18884 Number of successful extensions: 29 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -