BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120100.Seq (827 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-545|AAF59166.2| 922|Drosophila melanogaster CG14766-PA... 31 1.9 DQ902587-1|ABI94369.1| 2009|Drosophila melanogaster calmodulin-b... 29 7.8 >AE013599-545|AAF59166.2| 922|Drosophila melanogaster CG14766-PA protein. Length = 922 Score = 31.1 bits (67), Expect = 1.9 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +1 Query: 565 PASKKRQTAVLTNANLA--ELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYDEVLT 738 P S+KR+ +T N + E K LYS + +++ET N +PL Y L Sbjct: 827 PVSEKRELISITKPNQSDCEAKHRSHKDVNLYSRYPKIISETLENLTSPLRFENYTRELL 886 Query: 739 RDF 747 + + Sbjct: 887 KAY 889 >DQ902587-1|ABI94369.1| 2009|Drosophila melanogaster calmodulin-binding transcriptionactivator protein. Length = 2009 Score = 29.1 bits (62), Expect = 7.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 144 NMPEQQSSTETAAVCKNEKLLNKLESSSYNKSN 242 N +Q ++T TAA C N K N L S+ +N Sbjct: 1021 NQQQQITTTSTAATCDNLKSANALSEDSHTVNN 1053 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,768,916 Number of Sequences: 53049 Number of extensions: 791861 Number of successful extensions: 2108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2108 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3921660132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -