BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120099.Seq (809 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 1.4 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 1.4 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 1.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 1.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 1.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 1.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 1.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 1.4 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 1.4 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.5 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 5.8 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 5.8 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -1 Query: 266 NNFGHNFNVDEIKVHQLMNDHPNFIKIYFNHGFI 165 ++ +N+N + N++ N+ K+Y+N +I Sbjct: 83 SSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -1 Query: 266 NNFGHNFNVDEIKVHQLMNDHPNFIKIYFNHGFI 165 ++ +N+N + N++ N+ K+Y+N +I Sbjct: 83 SSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -1 Query: 266 NNFGHNFNVDEIKVHQLMNDHPNFIKIYFNHGFI 165 ++ +N+N + N++ N+ K+Y+N +I Sbjct: 83 SSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -1 Query: 266 NNFGHNFNVDEIKVHQLMNDHPNFIKIYFNHGFI 165 ++ +N+N + N++ N+ K+Y+N +I Sbjct: 83 SSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -1 Query: 266 NNFGHNFNVDEIKVHQLMNDHPNFIKIYFNHGFI 165 ++ +N+N + N++ N+ K+Y+N +I Sbjct: 83 SSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -1 Query: 266 NNFGHNFNVDEIKVHQLMNDHPNFIKIYFNHGFI 165 ++ +N+N + N++ N+ K+Y+N +I Sbjct: 83 SSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -1 Query: 266 NNFGHNFNVDEIKVHQLMNDHPNFIKIYFNHGFI 165 ++ +N+N + N++ N+ K+Y+N +I Sbjct: 83 SSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -1 Query: 266 NNFGHNFNVDEIKVHQLMNDHPNFIKIYFNHGFI 165 ++ +N+N + N++ N+ K+Y+N +I Sbjct: 83 SSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 24.2 bits (50), Expect = 1.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 387 VCSVHLWRWWWP*RIVNMN 443 VC + +WWW +I N++ Sbjct: 358 VCQNEMNKWWWNMKISNLS 376 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 513 YCGSANYQRQHLRQHSVAEQR 575 Y +ANY +L +H+V EQR Sbjct: 198 YLLAANYTGWYLTKHNVPEQR 218 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 513 YCGSANYQRQHLRQHSVAEQR 575 Y +ANY +L +H+V EQR Sbjct: 198 YLLAANYTGWYLTKHNVPEQR 218 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.2 bits (45), Expect = 5.8 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 373 YENCKNVKTRYKIINGRFGKISIL 302 YE+C + + +KI +F ++ +L Sbjct: 121 YEDCSGIVSAFKIAVDKFDRLWVL 144 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 22.2 bits (45), Expect = 5.8 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 220 WWTFISSTLKLW 255 +W+FI ST+ LW Sbjct: 395 FWSFIVSTILLW 406 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,212 Number of Sequences: 438 Number of extensions: 4523 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -