BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120094.Seq (823 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_458| Best HMM Match : DUF19 (HMM E-Value=1.5) 30 2.6 SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 554 FFGSFHRCLQFR*PFDFVAFD-TFHFYTLIYNICL*GVF 441 FF F RC Q+ P F F F + ++++CL GVF Sbjct: 22 FFAMFTRCFQYVYPVFFAMFTRCFRYVYPVFSLCLPGVF 60 >SB_458| Best HMM Match : DUF19 (HMM E-Value=1.5) Length = 518 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +1 Query: 43 YLLIRGDYESSSELKSLRDLNPWVQNTLLKLL 138 Y L+RG +SS E+KS+R +PW LL L+ Sbjct: 68 YYLVRGFLKSSEEMKSIRH-SPWSVVALLTLV 98 >SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 539 EKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYM 646 +K +K + L + +LK L E Y+ LK K L KY+ Sbjct: 89 QKGKKPFYLRKSELKKLELAEKYKELKSKGKLQKYL 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,705,244 Number of Sequences: 59808 Number of extensions: 398428 Number of successful extensions: 686 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -