BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120092.Seq (736 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12420| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 9e-23 SB_38647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_38582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_5369| Best HMM Match : wnt (HMM E-Value=2.9e-18) 29 3.0 SB_37040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_37986| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_19057| Best HMM Match : ADH_zinc_N (HMM E-Value=5.9e-13) 29 5.2 SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) 29 5.2 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 >SB_12420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 104 bits (249), Expect = 9e-23 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = -2 Query: 438 IKCLAAVAWEAGKPLSIEEIEVDPPKAGEVRVKITATGVCHTDAYTLSGKDPEGVFPVVL 259 I C AAVAWE KPLSIE IEV PPKA EVR+KI ATGVCHTDAYTLSG DPEG+FP +L Sbjct: 2 ITCQAAVAWEPKKPLSIETIEVAPPKAHEVRIKILATGVCHTDAYTLSGVDPEGLFPCIL 61 Query: 258 G 256 G Sbjct: 62 G 62 >SB_38647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 395 Score = 31.5 bits (68), Expect = 0.73 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 199 GDHVVPLYVPQCNTCKFCLNPKTNLCQKVRSTQGQGVMPDG 77 GD VV CNTCK C + + C+K + GV +G Sbjct: 126 GDRVVVNPNSSCNTCKACRRGQPHFCEKGGTGSAIGVWKNG 166 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -2 Query: 417 AWEAGKPLSIEEIEVDPPKAGEVRVKITATGVCHTDAYTL 298 AW G L ++ V P A + +IT TG T AYTL Sbjct: 361 AWSFGLKLGLKSQNVGPGPAYLIPARITRTGTDGTPAYTL 400 >SB_38582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 29.5 bits (63), Expect = 3.0 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = -3 Query: 482 IGSCPVQSCQQSVK*LSAWPQSRGKQASRCPSRRLKWTRQKPVKCALRSRPPESAILTRI 303 +GS P +S + +K +P+ R + +S S L K K R E+AIL R Sbjct: 987 VGSGP-ESIKMRIKGSRKFPKMRRQLSSTTTSAEL--IEHKQSKTTPSGRKLETAILRRA 1043 Query: 302 HSPEKI 285 HSP+ + Sbjct: 1044 HSPQTV 1049 >SB_5369| Best HMM Match : wnt (HMM E-Value=2.9e-18) Length = 354 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 546 SDILLHHRVSASYSTIISTFCDWQLSSAVMSTVGKV 439 SDIL HR S Y T+CD LS + T+ ++ Sbjct: 201 SDILKPHRKSLVYMVHSPTYCDPDLSRGIAGTMSRL 236 >SB_37040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = -3 Query: 452 QSVK*LSAWPQSRGKQASRCPSRRLKWTRQKPVKCALRSRPPESAILTRIH 300 QS L+ P +RG Q + R KW + P KC ++ + E A++ R+H Sbjct: 3 QSGNALTPLPHTRGIQTNTLLLR--KWAVEAPSKCRMKGQTKE-AVVQRVH 50 >SB_37986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 348 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 199 GDHVVPLYVPQCNTCKFCLNPKTNLCQKVRSTQGQGVMPDG 77 GD VV + C C FCL + +LC+ G+ +G Sbjct: 78 GDRVVINPLTSCGICDFCLKGQPHLCKVEGKNTAIGIKRNG 118 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 232 SPRFRRLQSQYYRKHSLRIFSGECIRVSMADSGGRDLNAH 351 SP+ + L SQ++ + +L IF G + VS + G LNAH Sbjct: 2544 SPQLKSLDSQHFHEPALGIFKGLAL-VSQLEQ-GNPLNAH 2581 >SB_19057| Best HMM Match : ADH_zinc_N (HMM E-Value=5.9e-13) Length = 303 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 205 KPGDHVVPLYVPQCNTCKFCLNPKTNLCQKV 113 K GD V C TC +C + NLC K+ Sbjct: 74 KEGDRVAIEPGTPCRTCSYCKKGRYNLCAKM 104 >SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) Length = 1281 Score = 28.7 bits (61), Expect = 5.2 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -3 Query: 455 QQSVK*LSAWPQSRGKQASRCPSRRLKWTRQKPV-KCALRSRPPESAILTRIHSPE 291 Q S K ++ PQ + KQASR LK KP + SRP ++++ T+ P+ Sbjct: 52 QASRKTKTSKPQDQDKQASRPRQASLKTKTSKPQDQDKQASRPRQASLKTKTSKPQ 107 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +2 Query: 329 VAVILTRTSPAFGGSTSISSMDSGLPASHATAAKHLITLPTVDMTALDN 475 V+V S + G +S SS +P+S + T+PT DM A N Sbjct: 3 VSVAENTPSSSSGDPSSHSSQSQSVPSSMDSGGSTAATVPTQDMVAFAN 51 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,960,152 Number of Sequences: 59808 Number of extensions: 506964 Number of successful extensions: 1365 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1362 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -