BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120092.Seq (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 25 0.98 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.3 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 23 3.9 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 23 3.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.1 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 24.6 bits (51), Expect = 0.98 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 639 WSWSSVGSCDDL 674 W W +VG+CD L Sbjct: 234 WEWHTVGNCDGL 245 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 2.3 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -3 Query: 362 KPVKCALRSRPPESAILTRIHSPEKIL 282 + + C LR+ P +L +H+ ++L Sbjct: 1102 RDLPCVLRASTPAPVVLEAVHASRRVL 1128 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 22.6 bits (46), Expect = 3.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 586 SIK*INLYICLFVHS*QSGRGHQLDPATTCS*ISWEISPVVS 711 S++ I +Y + + RG DP T ISW I+ VV+ Sbjct: 182 SVQGIIIYRAAYFGFYDTARGMLPDPKKTPFLISWGIAQVVT 223 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 22.6 bits (46), Expect = 3.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 586 SIK*INLYICLFVHS*QSGRGHQLDPATTCS*ISWEISPVVS 711 S++ I +Y + + RG DP T ISW I+ VV+ Sbjct: 182 SVQGIIIYRAAYFGFYDTARGMLPDPKKTPFLISWGIAQVVT 223 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 338 ILTRTSPAFGGSTS 379 +L R SPAF G++S Sbjct: 920 LLERASPAFSGTSS 933 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,462 Number of Sequences: 438 Number of extensions: 4529 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -