BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120090.Seq (807 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02350.1 68418.m00158 DC1 domain-containing protein contains ... 30 1.6 At4g38730.1 68417.m05486 expressed protein 30 2.1 At5g19470.1 68418.m02320 MutT/nudix family protein similar to SP... 29 4.8 At4g09640.1 68417.m01584 expressed protein several hypothetical ... 29 4.8 At1g31540.1 68414.m03869 disease resistance protein (TIR-NBS-LRR... 29 4.8 At5g46270.1 68418.m05696 disease resistance protein (TIR-NBS-LRR... 28 6.3 At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) fa... 28 6.3 At5g02330.1 68418.m00156 DC1 domain-containing protein contains ... 28 6.3 At3g26550.1 68416.m03314 DC1 domain-containing protein contains ... 28 6.3 At3g23870.1 68416.m03000 permease-related low similarity to puri... 28 6.3 At1g34470.1 68414.m04283 permease-related low similarity to puri... 28 6.3 At1g71900.1 68414.m08312 expressed protein 28 8.4 At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c... 28 8.4 >At5g02350.1 68418.m00158 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 651 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +1 Query: 562 DDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITI 714 D++++C+ C I + C++ L CA A++ +H G +T+ Sbjct: 388 DENIICQACILPIYEGNYYSCMDQCDFVLHEACANASRKKDHALHGHPLTL 438 >At4g38730.1 68417.m05486 expressed protein Length = 326 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFKPVNDQAVD 520 FN + PI+Y FT L ++ I+FK N Q D Sbjct: 237 FNAAIVSPIYYVMFTTL--TIVASAIMFKDWNGQNTD 271 >At5g19470.1 68418.m02320 MutT/nudix family protein similar to SP|P41888 Thiamine pyrophosphokinase (EC 2.7.6.2) (TPK) (Thiamine kinase) {Schizosaccharomyces pombe}; contains Pfam profile PF00293: NUDIX domain Length = 365 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 613 EDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAVLVK-EGRPKCVYRCCPILQSR 783 E++ + Y H + Y N I +G ++T+N +L K E R + V IL ++ Sbjct: 102 EEQIVGYIHKGFTKYLRDFNDIFTFSQYGGHVTLNMMLDKPEERTRAVAHVIKILGNK 159 >At4g09640.1 68417.m01584 expressed protein several hypothetical proteins - Arabidopsis thaliana Length = 386 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFKPVNDQA 526 FNT V PI+Y FT L ++ +I+FK + Q+ Sbjct: 251 FNTAVVSPIYYVMFTSL--TILASVIMFKDWDRQS 283 >At1g31540.1 68414.m03869 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 776 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 201 ILKLNFCNSLIEPTSTDLSINPLLN 127 IL L FC SL+E S+ ++N LLN Sbjct: 655 ILNLKFCESLVELPSSIRNLNKLLN 679 >At5g46270.1 68418.m05696 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1145 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 201 ILKLNFCNSLIEPTSTDLSINPLL 130 ILKL FC SL+E S+ ++N LL Sbjct: 654 ILKLGFCKSLVELPSSIRNLNKLL 677 >At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 4706 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 5 VVSMCVDNAFA-YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFI 145 V S+ +N FA D LLK +S + K P+K Q V ++ S+G I Sbjct: 1644 VFSLLDENIFAGMNKDQLLKKLSNTVVKDLPYKCQKIVVTEQDSSGCI 1691 >At5g02330.1 68418.m00156 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 656 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/68 (20%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +1 Query: 562 DDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAVL-VKEG 738 +++++C+ C I + C++ + L CA A++ +H +T+ V ++ Sbjct: 388 NENIICQACILPIYEGNYYSCMDQCNFILHEACANASRKKDHALHSHPLTLKVVSDIQNE 447 Query: 739 RPKCVYRC 762 K +RC Sbjct: 448 YFKGYFRC 455 >At3g26550.1 68416.m03314 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 681 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/67 (25%), Positives = 27/67 (40%) Frame = +1 Query: 562 DDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAVLVKEGR 741 D++ C C I C+E + L CA A ++ H +T+N + G Sbjct: 371 DENKYCRGCSFPIYEGQFYSCMECDFI-LHESCANAPRMKRHPLHPHPLTLNVATKELGN 429 Query: 742 PKCVYRC 762 + VY C Sbjct: 430 NEGVYHC 436 >At3g23870.1 68416.m03000 permease-related low similarity to purine permease [Arabidopsis thaliana] GI:7620007; contains 9 predicted transmembrane domains; contains Pfam PF05653: Protein of unknown function (DUF803); identified as COG0697, Permeases of the drug/metabolite transporter (DMT) superfamily Length = 335 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544 FNT V P++Y FT +I +I+FK Sbjct: 240 FNTAVISPVYYVMFT--TFTIIASMIMFK 266 >At1g34470.1 68414.m04283 permease-related low similarity to purine permease [Arabidopsis thaliana] GI:7620007 Length = 368 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544 FNT V PI+Y FT L ++ +I+FK Sbjct: 251 FNTAVVSPIYYVMFTSL--TILASVIMFK 277 >At1g71900.1 68414.m08312 expressed protein Length = 343 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544 FNT + PI+Y FT L ++ +I+FK Sbjct: 251 FNTAIVSPIYYVMFTSL--TILASVIMFK 277 >At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein contains Pfam PF01422: NF-X1 type zinc finger; similar to transcriptional repressor NF-X1 (SP:Q12986) [Homo sapiens]; similar to EST gb|T21002 Length = 1188 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 736 GRPKCVYRCCPILQSRMDTFVNFW 807 GR +C RCCP+L + + W Sbjct: 573 GRHRCSERCCPLLNGKKNDLSGDW 596 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,949,029 Number of Sequences: 28952 Number of extensions: 312931 Number of successful extensions: 840 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 840 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -