BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120087.Seq (771 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 25 2.6 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 4.5 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 25.0 bits (52), Expect = 2.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 327 FSEFIPVCLFVCLHMYILYLSNY 395 F EF+P VC+++ + L NY Sbjct: 265 FYEFLPYLAIVCMNLVVPQLFNY 287 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.2 bits (50), Expect = 4.5 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -1 Query: 663 NLHIQPFTSKLLYSFKIPSSNLQS-CFLKNTILF-TINSNFYCTQLTTIF 520 NLH+ P T + + +P L + F+ N + F I + + TIF Sbjct: 295 NLHVSPLTPNTFFFYMLPPIILDAGYFMPNRMFFDNIGTILLMAVIGTIF 344 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 782,661 Number of Sequences: 2352 Number of extensions: 14920 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -