BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120087.Seq (771 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50910.1 68418.m06312 hypothetical protein 28 7.9 >At5g50910.1 68418.m06312 hypothetical protein Length = 116 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 318 NQPFSEFIPVCLFVCLHMYILYLSNYAFSCSFHK*TRANLKQN 446 NQ + F+ + + HM+I ++Y F+C+F +NL ++ Sbjct: 18 NQWTTHFVNLMHIISPHMFISKYTSYNFNCAFRFFASSNLSKS 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,265,004 Number of Sequences: 28952 Number of extensions: 280076 Number of successful extensions: 482 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -