BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120084.Seq (769 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41212| Best HMM Match : ICA69 (HMM E-Value=2.3) 32 0.59 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 31 0.77 SB_14155| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_40913| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_23554| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_44454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_8504| Best HMM Match : SpoU_methylase (HMM E-Value=1.7e-28) 29 5.5 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 28 7.2 SB_53890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 28 9.5 SB_13659| Best HMM Match : Peptidase_C5 (HMM E-Value=0.00051) 28 9.5 SB_21258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_16965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_41212| Best HMM Match : ICA69 (HMM E-Value=2.3) Length = 361 Score = 31.9 bits (69), Expect = 0.59 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 4/70 (5%) Frame = +1 Query: 541 RTDYKNESDVINENNLI----TQIFVQFFYNLICDKAYSLYTKRDMCVPFVKECKKATIG 708 RTD E + N N ++ + FFYN D+ LY+ + P V C K + Sbjct: 19 RTDDSLEKNKNNNNEVVFLHCNSNLLPFFYN---DEFQYLYSDTALVRPAVSVCTKRPLA 75 Query: 709 LRQEGSRARV 738 + Q G RAR+ Sbjct: 76 ISQYGPRARL 85 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 31.5 bits (68), Expect = 0.77 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -2 Query: 747 KILNTRS*SFLAQSDGCFFAFFDKWHAHVAFCVQRIRFVANQVIEKLHK 601 K NTRS G F ++HV C Q+ ANQVIE +H+ Sbjct: 363 KETNTRSSKISCPICGLVFKTTKSRNSHVKKCAQKNNIPANQVIEIMHR 411 >SB_14155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 31.5 bits (68), Expect = 0.77 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -2 Query: 747 KILNTRS*SFLAQSDGCFFAFFDKWHAHVAFCVQRIRFVANQVIEKLHK 601 K NTRS G F ++HV C Q+ ANQVIE +H+ Sbjct: 363 KETNTRSSKISCPICGLVFKTTKSRNSHVKKCAQKNNIPANQVIEIMHR 411 >SB_40913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -2 Query: 549 IGPKQHVQHERHANMGLKKMSQPFCKPSSRVLSEDAKYLHLHSKH*IL 406 +GP Q + K +S+ F S +A ++HLH+ H +L Sbjct: 74 VGPTQRAAAKEATEPSAKTISKAFSMEMSNSFPFEASFIHLHNLHVVL 121 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = +3 Query: 258 KTFFRYFCATSSSNKCPNLGPLCNTCKHITIRRRHPTWTRSCVSRASPQTKFNVSSANAD 437 K + Y CAT+ + K P GP KHI +R P + A T S A++D Sbjct: 4800 KCYDDYLCATTHT-KLPGFGPQVIRIKHIVRPKRPPKPQIDTIFNAIEPTGPTKSCAHSD 4858 Query: 438 TWR 446 ++ Sbjct: 4859 IFK 4861 >SB_23554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 29.1 bits (62), Expect = 4.1 Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 1/87 (1%) Frame = +1 Query: 208 KVVLRIKPTTQTTYTIKKHFFDIFARRVHQTSAPI*DHYAILANILQSDAGTRRGRDHVS 387 K+++R + YT K F R HQ + Y + I +SD G RGR VS Sbjct: 106 KLIIRKASSVIERYTCIK-----FEERKHQRDYV--EFYMDKSGICESDIGRIRGRQTVS 158 Query: 388 VVQ-ARKQNSMFRVQMQILGVLAEHPR 465 + Q R + M LG EH R Sbjct: 159 LGQGCRNPGHVTHELMHTLGFYHEHTR 185 >SB_44454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 645 FVHKTRHVRAICQRMQKSNHRI 710 FVH T HVRA+ QR++ R+ Sbjct: 689 FVHDTFHVRALSQRLRDGQRRV 710 >SB_8504| Best HMM Match : SpoU_methylase (HMM E-Value=1.7e-28) Length = 647 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 297 NKCPNLGPLCNTCKHITIRR 356 NK PNLG LC TC+ +R Sbjct: 470 NKAPNLGGLCRTCEIFGAKR 489 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/67 (23%), Positives = 30/67 (44%) Frame = +2 Query: 260 NIFSIFLRDEFIKQVPQFRTIMQYLQTYYNPTPAPDVDEIMCQSCKPANKIQCFECKCRY 439 +IFS +EF++ P R + L + P D+D + S + + +CK + Sbjct: 746 HIFSPSASEEFVRAQPNNREPLLGLGSIQLTVPEADLDSLYSWSLEHGMEFSASKCKVVH 805 Query: 440 LASSLST 460 ++ ST Sbjct: 806 MSKKRST 812 >SB_53890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 667 TCRVLCTKNTLCRKSSYRK 611 TC LCT+NT CR ++ K Sbjct: 54 TCAHLCTRNTECRSINFEK 72 >SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) Length = 504 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 667 TCRVLCTKNTLCRKSSYRK 611 TC LCT+NT CR ++ K Sbjct: 40 TCAHLCTRNTECRSINFEK 58 >SB_13659| Best HMM Match : Peptidase_C5 (HMM E-Value=0.00051) Length = 1024 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 645 FVHKTRHVRAICQRMQKSNHRIAP 716 FVH T HVRA+ QR + R P Sbjct: 984 FVHDTFHVRALSQRRLRDGQRRVP 1007 >SB_21258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 461 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -1 Query: 148 IKLWLKYFENKKHNESISSRNNCASKHTFSKRSYVLNLKLYCNL 17 IKLWLK N +NE +S + + A + +K + +K +L Sbjct: 361 IKLWLKLSNNNGNNEKLSRKASAAISNYENKNFWHRKIKQILHL 404 >SB_16965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 27.9 bits (59), Expect = 9.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 264 FFRYFCATSSSNKCP 308 FFRY+C+ S S CP Sbjct: 36 FFRYYCSISQSEHCP 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,709,473 Number of Sequences: 59808 Number of extensions: 586706 Number of successful extensions: 1920 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1919 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -