BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120084.Seq (769 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97008-11|AAK72054.1| 224|Caenorhabditis elegans Hypothetical p... 29 3.6 Z81542-3|CAB04415.1| 308|Caenorhabditis elegans Hypothetical pr... 29 4.8 Z93388-6|CAB07663.1| 369|Caenorhabditis elegans Hypothetical pr... 28 6.4 Z75549-5|CAA99918.1| 364|Caenorhabditis elegans Hypothetical pr... 28 6.4 AF099913-8|ABB51194.1| 301|Caenorhabditis elegans Hypothetical ... 28 6.4 AF067942-6|AAG45579.1| 345|Caenorhabditis elegans Hypothetical ... 28 8.4 >U97008-11|AAK72054.1| 224|Caenorhabditis elegans Hypothetical protein C03G6.5 protein. Length = 224 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -1 Query: 196 IHLLNSVKKVRPLPSTIKLWLKYFENKKHN-ESISSRNNCASKHTFSKRSYVLNLKLYCN 20 + L + +KV L K LK F+ + S S NC +K K YV ++K YC+ Sbjct: 75 VRLSDFAEKVDNLDMNDKTKLKEFKRSCDSLHSCYSNLNCTTKSDDEKDKYVESIKQYCD 134 >Z81542-3|CAB04415.1| 308|Caenorhabditis elegans Hypothetical protein F49A5.4 protein. Length = 308 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 469 LVEGAQRGRQVSAFALETLNFVCGLARLTHD 377 + G Q G+ SA ET++FVC L +D Sbjct: 157 MTNGTQAGKWASASCTETMSFVCELPATIYD 187 >Z93388-6|CAB07663.1| 369|Caenorhabditis elegans Hypothetical protein T10C6.7 protein. Length = 369 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = +1 Query: 493 FFKTHVGMPLMLYVLLRTDYKNESDVINENNLITQIFVQFFYNLICDKAYSLYTKRDMCV 672 FFK H + L L+ LRT Y+NE ++ + N++ I + N + K +++ +C+ Sbjct: 173 FFKNH--LVLKLHGELRTIYENELQLLPKKNVLHGIVIDL--NSVNFKEEKIFSLPHVCI 228 >Z75549-5|CAA99918.1| 364|Caenorhabditis elegans Hypothetical protein T19C4.5 protein. Length = 364 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = +3 Query: 225 QANNTDNIHN*KTFFRYFCATSSSNKCPNLGPLCNTCKHITIRRRHPTWTRSCVSRASPQ 404 Q +D++ KT R A + S+ N +CN+C ++ +R+P + S Q Sbjct: 193 QLQESDHLDVEKTQSRMEDAVTDSSSTDNTSNMCNSCTSLSSGQRYPKPLTTRNSETQMQ 252 Query: 405 TKFNVSS 425 T SS Sbjct: 253 TLKEESS 259 >AF099913-8|ABB51194.1| 301|Caenorhabditis elegans Hypothetical protein C29F9.4 protein. Length = 301 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/80 (22%), Positives = 34/80 (42%) Frame = +3 Query: 12 AYRLQYSLRFNTYDRFENVCFEAQLLRDEIDSLCFLFSKYFNQSLIVDGKGLTFFTEFNK 191 AY+ + S+ +D FEN+ + D++ S+ + K + +++ T E Sbjct: 161 AYKRKKSVITEVFDEFENILWSVCSFSDKLTSIS-CYKKEMDPDCLIENVN-TLSNELEN 218 Query: 192 CIVSIKSSFENQANNTDNIH 251 + + F NTD IH Sbjct: 219 -FEKVTAEFTKYLVNTDGIH 237 >AF067942-6|AAG45579.1| 345|Caenorhabditis elegans Hypothetical protein ZK6.4 protein. Length = 345 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +1 Query: 40 LTRTTASKTCVLKRNCYEMKSI--RCVF 117 +TRTT K C L NC+ I +CVF Sbjct: 36 ITRTTPVKKCYLGENCFTKTPITQKCVF 63 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,155,797 Number of Sequences: 27780 Number of extensions: 444122 Number of successful extensions: 1601 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1601 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -