BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120081.Seq (778 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989010-1|ABK97611.1| 408|Drosophila melanogaster gustatory re... 29 9.4 AE014298-1614|AAN09631.1| 408|Drosophila melanogaster CG32664-P... 29 9.4 >DQ989010-1|ABK97611.1| 408|Drosophila melanogaster gustatory receptor 10a protein. Length = 408 Score = 28.7 bits (61), Expect = 9.4 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 148 RSKLPYIRPNFPQKERKKYTFFILSKYCI*NKNIANTVC 264 R+ L + N PQ+ ++ + FF+ K+C+ N + VC Sbjct: 124 RTHLEFEFKNAPQEPKRPFEFFMYFKFCLINLMMMIQVC 162 >AE014298-1614|AAN09631.1| 408|Drosophila melanogaster CG32664-PA protein. Length = 408 Score = 28.7 bits (61), Expect = 9.4 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 148 RSKLPYIRPNFPQKERKKYTFFILSKYCI*NKNIANTVC 264 R+ L + N PQ+ ++ + FF+ K+C+ N + VC Sbjct: 124 RTHLEFEFKNAPQEPKRPFEFFMYFKFCLINLMMMIQVC 162 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,387,432 Number of Sequences: 53049 Number of extensions: 661627 Number of successful extensions: 1339 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1339 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3602427675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -