BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120081.Seq (778 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30090.1 68414.m03678 kelch repeat-containing F-box family pr... 29 4.5 At1g76110.1 68414.m08838 high mobility group (HMG1/2) family pro... 28 6.0 >At1g30090.1 68414.m03678 kelch repeat-containing F-box family protein similar to SP|O95198 Kelch-like protein 2 (Actin-binding protein Mayven) {Homo sapiens}; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 398 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 142 GKIRDEKTQNWNAKRQN-REGLLGLSLISYNRFF 44 G++ D +T W REG G S++ Y+R F Sbjct: 273 GQVYDPRTDQWETMSMGLREGWTGTSVVIYDRLF 306 >At1g76110.1 68414.m08838 high mobility group (HMG1/2) family protein / ARID/BRIGHT DNA-binding domain-containing protein low similarity to high mobility group protein [Plasmodium falciparum] GI:790198; contains Pfam profiles PF00505: HMG (high mobility group) box, PF01388: ARID/BRIGHT DNA binding domain Length = 338 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 172 PNFPQKERKKYTFFILSKYC 231 PN+P+ R Y FF K+C Sbjct: 252 PNYPKPNRSGYNFFFAEKHC 271 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,410,299 Number of Sequences: 28952 Number of extensions: 344762 Number of successful extensions: 778 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -