BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120080.Seq (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 25 1.8 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 25 1.8 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 25 1.8 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 25 1.8 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 25 1.8 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 24 5.4 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 24 5.4 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 24 5.4 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 24 5.4 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 5.4 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 23 7.1 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 7.1 AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. 23 7.1 AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. 23 7.1 AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. 23 7.1 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 7.1 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 9.4 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 394 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 483 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 25.4 bits (53), Expect = 1.8 Identities = 15/67 (22%), Positives = 25/67 (37%) Frame = +3 Query: 174 VIVNVDKKYKTTYSESGSIPYTPAPDNWSSKVTHCTCSRTQCSSPRRVLSN*L*RASSLT 353 V++ +K ++P TP P + + +C+ PR V + T Sbjct: 17 VVIASAEKTDQEAEHGETVPATPEPSTTEATEEESPPPKIECTDPREVYNECGSSCDDRT 76 Query: 354 LWNCRRG 374 N RRG Sbjct: 77 CENIRRG 83 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 394 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 483 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 394 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 483 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 394 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 483 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +3 Query: 249 DNWSSKVTHCTCSRTQCSSP 308 D+WS CT T C +P Sbjct: 11 DSWSGDNCECTTDTTGCKAP 30 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +3 Query: 249 DNWSSKVTHCTCSRTQCSSP 308 D+WS CT T C +P Sbjct: 11 DSWSGDNCECTTDTTGCKAP 30 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +3 Query: 249 DNWSSKVTHCTCSRTQCSSP 308 D+WS CT T C +P Sbjct: 11 DSWSGDNCECTTDTTGCKAP 30 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +3 Query: 249 DNWSSKVTHCTCSRTQCSSP 308 D+WS CT T C +P Sbjct: 11 DSWSGDNCECTTDTTGCKAP 30 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +3 Query: 249 DNWSSKVTHCTCSRTQCSSP 308 D+WS CT T C +P Sbjct: 587 DSWSGDNCECTTDTTGCKAP 606 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 23.4 bits (48), Expect = 7.1 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 226 DPDSLYVVLYFLSTLTIT 173 +P +L +VL FLS LT+T Sbjct: 6 EPRALGIVLAFLSVLTLT 23 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.4 bits (48), Expect = 7.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 239 GIWYRPRLAVRRFVFFVNINYHSLFTI 159 GI R ++++ FF+NI +LFT+ Sbjct: 270 GILRRSSMSMKDRNFFINITLFALFTL 296 >AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.4 bits (48), Expect = 7.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 564 QANTMLNEARRETAQLANRMADIAQDVIAKPNNPQLLHSL 683 +AN EA R LAN+M D AQ + N +L +L Sbjct: 160 EANQYNREADRIAEDLANKMRDHAQLLENVGTNIELAETL 199 >AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.4 bits (48), Expect = 7.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 564 QANTMLNEARRETAQLANRMADIAQDVIAKPNNPQLLHSL 683 +AN EA R LAN+M D AQ + N +L +L Sbjct: 160 EANQYNREADRIAEDLANKMRDHAQLLENVGTNIELAETL 199 >AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.4 bits (48), Expect = 7.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 564 QANTMLNEARRETAQLANRMADIAQDVIAKPNNPQLLHSL 683 +AN EA R LAN+M D AQ + N +L +L Sbjct: 160 EANQYNREADRIAEDLANKMRDHAQLLENVGTNIELAETL 199 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 7.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 564 QANTMLNEARRETAQLANRMADIAQDVIAKPNNPQLLHSL 683 +AN EA R LAN+M D AQ + N +L +L Sbjct: 1299 EANQYNREADRIAEDLANKMRDHAQLLENVGTNIELAETL 1338 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +2 Query: 311 EGVIQLIMKSKLPYAVELQAWLLEEVIPQCCARASTRRPSRWTQI 445 EGV ++ + P E+++ LL+ V+P+ + P+ W+ + Sbjct: 964 EGVEHVMFEC--PRFAEVRSELLDGVLPETLEAHMLQSPTNWSNV 1006 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 764,414 Number of Sequences: 2352 Number of extensions: 15519 Number of successful extensions: 37 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -