BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120079.Seq (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 24 4.3 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 5.6 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = -1 Query: 709 VCCIVLMASNNCSANLSNMSVKSGNESVISE 617 VCC + NC ++ + + GN++ + E Sbjct: 81 VCCPAFVNEPNCGPSVFGVRIIGGNDTELGE 111 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 5.6 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 4/34 (11%) Frame = +3 Query: 228 ERLARLPTSA----EHIYCKQLFVLLLPSSPITI 317 +R R PT++ + + C++LF+ L SS +TI Sbjct: 92 QRATRAPTTSTWTSKSVLCEELFLFLRRSSLVTI 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,479 Number of Sequences: 2352 Number of extensions: 13635 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -