BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120079.Seq (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.7 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 3.0 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 4.0 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 23 4.0 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 5.2 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 1.7 Identities = 16/63 (25%), Positives = 30/63 (47%) Frame = +3 Query: 453 KRHVDEQRQPNKSQPN*SILELSNVMTGVRNQNVQLLAALETAKDVILTRLNTLLSEITD 632 + +VD +R+PN +L + + + NQN ++ +L+ +L L+EI D Sbjct: 509 RAYVDNRRRPNPGTVFARLLSVLTELRTLGNQNSEMCFSLKFKN----KKLPVFLAEIWD 564 Query: 633 SLP 641 P Sbjct: 565 VTP 567 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -1 Query: 427 RIFVAVLAWETMNVTAI*TGTEIANEVCREENVISSVIVIGDDG 296 ++FVA ET T+ T + +N++ S+ + DDG Sbjct: 151 KMFVARHLAETPKNTSAVRYTHYIGTLATNDNILESISYVKDDG 194 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 628 VISESNVFNLVKITSL 581 VI+ S +FNLVKI+ L Sbjct: 296 VINFSGIFNLVKISPL 311 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 628 VISESNVFNLVKITSL 581 VI+ S +FNLVKI+ L Sbjct: 46 VINFSGIFNLVKISPL 61 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 500 VWLRFIW 480 VWLRFIW Sbjct: 77 VWLRFIW 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,429 Number of Sequences: 438 Number of extensions: 3471 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -