BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120077.Seq (775 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB007880-1|BAA24850.2| 756|Homo sapiens KIAA0420 protein. 31 4.6 AY463956-1|AAR27594.1| 324|Homo sapiens BSAP splice variant del... 30 8.0 >AB007880-1|BAA24850.2| 756|Homo sapiens KIAA0420 protein. Length = 756 Score = 31.1 bits (67), Expect = 4.6 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 2/84 (2%) Frame = -1 Query: 469 LGGESEGTMEAA--IKRSILQGLLHQNYDLPLIERENQPILFGHITRSNTVILEKQWILE 296 LG GT + I + + G + + PL+ RE + I H+TR V L QW + Sbjct: 620 LGAREPGTRASGQLIDKGWVLGRDYSRVEAPLVCREGESIQGSHVTRWPGVYL-LQWQMH 678 Query: 295 PIKGEVILRLNSITCFRTAVGEPG 224 V L + TA+ PG Sbjct: 679 SPPSSVACSLPGVDDVLTALHSPG 702 >AY463956-1|AAR27594.1| 324|Homo sapiens BSAP splice variant delta78 protein. Length = 324 Score = 30.3 bits (65), Expect = 8.0 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +3 Query: 165 HKSFIFTLQNFILPHLGVIYPGSPTAVL 248 H S IFT I P GV +PG PTA L Sbjct: 245 HYSDIFTTTEPIKPEQGVSFPGVPTATL 272 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,435,380 Number of Sequences: 237096 Number of extensions: 2396020 Number of successful extensions: 4436 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4436 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9367263024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -