BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120076.Seq (601 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 23 2.0 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 22 4.6 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 22 4.6 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 23.0 bits (47), Expect = 2.0 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 99 KLLMAVST-MVLTRVSTKLVKAMLSAEARDKLT 4 K+++A+ T M LT+VST A + +K+T Sbjct: 117 KIMLAIITKMTLTQVSTWFANARRRLKKENKMT 149 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 441 NGSPSGNRHQQFPSQASTLP 500 + SPSG+ Q S AST P Sbjct: 37 SSSPSGSSPQHSSSSASTSP 56 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 441 NGSPSGNRHQQFPSQASTLP 500 + SPSG+ Q S AST P Sbjct: 37 SSSPSGSSPQHSSSSASTSP 56 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,972 Number of Sequences: 336 Number of extensions: 2445 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -