BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120075.Seq (786 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g28250.1 68418.m03425 Ulp1 protease family protein contains P... 30 2.0 At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family... 29 2.6 >At5g28250.1 68418.m03425 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 939 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 386 ASKRKNTTRSDDYESNKQPDYDMDL-SDFSITEVEATQYLTLL 261 A + N T S D ESN P Y L SDF++ + Q ++ + Sbjct: 408 ADESNNETASGDQESNPPPSYSRPLHSDFNLPSFQGDQAISTI 450 >At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family protein similar to SP|Q28141 ATP-dependent RNA helicase A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos taurus}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1015 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 497 STTAPLVFCKQNGFSGNACVISFSDHKLHFVSKISNKW 610 S+T+PL+ G C++ F D +HF S I+N++ Sbjct: 801 SSTSPLLDLFPTSSEG--CILVFDDSDMHFTSSIANRY 836 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,648,790 Number of Sequences: 28952 Number of extensions: 284738 Number of successful extensions: 771 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -