BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120073.Seq (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 25 0.84 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 25 0.84 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 25 0.84 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.4 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 21 7.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 7.8 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 137 NLQICSKFYVWQYSLKQHIFQFCMS*QFSLSCYH 36 +L+ S +V ++ + FCMS ++CY+ Sbjct: 82 SLRTPSNLFVINLAISNFLMMFCMSPPMVINCYY 115 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 137 NLQICSKFYVWQYSLKQHIFQFCMS*QFSLSCYH 36 +L+ S +V ++ + FCMS ++CY+ Sbjct: 48 SLRTPSNLFVINLAISDFLMMFCMSPPMVINCYY 81 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 24.6 bits (51), Expect = 0.84 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +2 Query: 557 CA*TIPCEGKKYWTLQRICLC 619 C+ + G K W ++R C+C Sbjct: 57 CSSYLQVSGSKIWQMERSCMC 77 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.4 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 11 IVTEYKYDND-NKKVKIVRTYKIEKCVVSKSIA 106 +V +Y YD D NK+ I I KCVV +A Sbjct: 100 VVAQY-YDTDVNKEYAIRGNSAILKCVVPSFVA 131 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 155 QACRWLNLQICSKFYVWQYSLKQHI 81 QA + + + C K YV +LK HI Sbjct: 12 QAKKSFSCKYCEKVYVSLGALKMHI 36 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 495 YTDGSYVFTTHRGL 454 Y DG+ VF H G+ Sbjct: 799 YIDGNVVFVCHNGM 812 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,104 Number of Sequences: 438 Number of extensions: 2952 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -