BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120071.Seq (801 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 53 2e-09 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 53.2 bits (122), Expect = 2e-09 Identities = 28/76 (36%), Positives = 43/76 (56%), Gaps = 4/76 (5%) Frame = +3 Query: 522 QTGSGKTLAYILPAIVHI--NNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHTS 689 QTGSGKT A++LP I ++ + PP + P+ ++++PTRELA QI F + S Sbjct: 203 QTGSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQGKKFAYNS 262 Query: 690 YVRNTCVFGGAPKREQ 737 V+ ++GG Q Sbjct: 263 TVKVAVIYGGTSTNHQ 278 Score = 41.1 bits (92), Expect = 1e-05 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +2 Query: 350 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 508 EV V+G + PI FE + ++ + VK GY +PT IQ P+ +SG++ Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRD 197 Score = 25.4 bits (53), Expect = 0.53 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 755 GSRIVIATPGRLIDF 799 G I++ATPGRL DF Sbjct: 285 GCHILVATPGRLKDF 299 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,188 Number of Sequences: 336 Number of extensions: 4295 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -