BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120070X.Seq (534 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC016728-1|AAH16728.1| 309|Homo sapiens aminoadipate-semialdehy... 32 1.1 BC015470-1|AAH15470.1| 309|Homo sapiens aminoadipate-semialdehy... 32 1.1 AL050073-1|CAB43257.1| 211|Homo sapiens hypothetical protein pr... 32 1.1 AF302110-1|AAG30872.1| 309|Homo sapiens alpha-aminoadipic semia... 32 1.1 AF201943-1|AAF86879.1| 333|Homo sapiens HAH-P protein. 32 1.1 AF151838-1|AAD34075.1| 309|Homo sapiens CGI-80 protein protein. 32 1.1 AF136978-1|AAG49439.1| 314|Homo sapiens proteinx0005 protein. 32 1.1 BC082760-1|AAH82760.1| 1062|Homo sapiens ATXN2L protein protein. 32 1.5 BC068012-1|AAH68012.1| 1098|Homo sapiens ATXN2L protein protein. 32 1.5 BC010239-1|AAH10239.1| 401|Homo sapiens ATXN2L protein protein. 32 1.5 AJ317972-1|CAC38070.3| 1097|Homo sapiens ataxin-2 related domain... 32 1.5 AJ317971-1|CAC38069.3| 1062|Homo sapiens ataxin-2 related domain... 32 1.5 AJ317970-1|CAC38068.1| 1075|Homo sapiens ataxin-2 related domain... 32 1.5 BC002607-1|AAH02607.1| 593|Homo sapiens likely ortholog of rat ... 30 4.5 AB040879-1|BAA95970.1| 645|Homo sapiens KIAA1446 protein protein. 30 4.5 AK124028-1|BAC85755.1| 160|Homo sapiens protein ( Homo sapiens ... 30 5.9 AJ317973-1|CAC38071.3| 1044|Homo sapiens ataxin-2 related domain... 29 7.8 >BC016728-1|AAH16728.1| 309|Homo sapiens aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase protein. Length = 309 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 179 P G+RHQ PSQ + P +F + N+ S VP Sbjct: 248 PDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVP 283 >BC015470-1|AAH15470.1| 309|Homo sapiens aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase protein. Length = 309 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 179 P G+RHQ PSQ + P +F + N+ S VP Sbjct: 248 PDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVP 283 >AL050073-1|CAB43257.1| 211|Homo sapiens hypothetical protein protein. Length = 211 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 179 P G+RHQ PSQ + P +F + N+ S VP Sbjct: 150 PDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVP 185 >AF302110-1|AAG30872.1| 309|Homo sapiens alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase protein. Length = 309 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 179 P G+RHQ PSQ + P +F + N+ S VP Sbjct: 248 PDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVP 283 >AF201943-1|AAF86879.1| 333|Homo sapiens HAH-P protein. Length = 333 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 179 P G+RHQ PSQ + P +F + N+ S VP Sbjct: 272 PDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVP 307 >AF151838-1|AAD34075.1| 309|Homo sapiens CGI-80 protein protein. Length = 309 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 179 P G+RHQ PSQ + P +F + N+ S VP Sbjct: 248 PDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVP 283 >AF136978-1|AAG49439.1| 314|Homo sapiens proteinx0005 protein. Length = 314 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 179 P G+RHQ PSQ + P +F + N+ S VP Sbjct: 249 PDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVP 284 >BC082760-1|AAH82760.1| 1062|Homo sapiens ATXN2L protein protein. Length = 1062 Score = 31.9 bits (69), Expect = 1.5 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 45 HPPRRHGGSPSGNRHQQ-FPSQASTLPISGKFQAHDINNQQSQLVPGF 185 HPP+ HGG P G Q P+ +++ P + H Q Q PGF Sbjct: 992 HPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQ-APGF 1038 >BC068012-1|AAH68012.1| 1098|Homo sapiens ATXN2L protein protein. Length = 1098 Score = 31.9 bits (69), Expect = 1.5 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 45 HPPRRHGGSPSGNRHQQ-FPSQASTLPISGKFQAHDINNQQSQLVPGF 185 HPP+ HGG P G Q P+ +++ P + H Q Q PGF Sbjct: 1015 HPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQ-APGF 1061 >BC010239-1|AAH10239.1| 401|Homo sapiens ATXN2L protein protein. Length = 401 Score = 31.9 bits (69), Expect = 1.5 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 45 HPPRRHGGSPSGNRHQQ-FPSQASTLPISGKFQAHDINNQQSQLVPGF 185 HPP+ HGG P G Q P+ +++ P + H Q Q PGF Sbjct: 318 HPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQ-APGF 364 >AJ317972-1|CAC38070.3| 1097|Homo sapiens ataxin-2 related domain protein protein. Length = 1097 Score = 31.9 bits (69), Expect = 1.5 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 45 HPPRRHGGSPSGNRHQQ-FPSQASTLPISGKFQAHDINNQQSQLVPGF 185 HPP+ HGG P G Q P+ +++ P + H Q Q PGF Sbjct: 992 HPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQ-APGF 1038 >AJ317971-1|CAC38069.3| 1062|Homo sapiens ataxin-2 related domain protein protein. Length = 1062 Score = 31.9 bits (69), Expect = 1.5 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 45 HPPRRHGGSPSGNRHQQ-FPSQASTLPISGKFQAHDINNQQSQLVPGF 185 HPP+ HGG P G Q P+ +++ P + H Q Q PGF Sbjct: 992 HPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQ-APGF 1038 >AJ317970-1|CAC38068.1| 1075|Homo sapiens ataxin-2 related domain protein protein. Length = 1075 Score = 31.9 bits (69), Expect = 1.5 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 45 HPPRRHGGSPSGNRHQQ-FPSQASTLPISGKFQAHDINNQQSQLVPGF 185 HPP+ HGG P G Q P+ +++ P + H Q Q PGF Sbjct: 992 HPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQ-APGF 1038 >BC002607-1|AAH02607.1| 593|Homo sapiens likely ortholog of rat brain-enriched guanylate kinase-associated protein protein. Length = 593 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQ 170 P+G +H+ FPS A +LP S + + +++ + Sbjct: 279 PAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKE 311 >AB040879-1|BAA95970.1| 645|Homo sapiens KIAA1446 protein protein. Length = 645 Score = 30.3 bits (65), Expect = 4.5 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 72 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQ 170 P+G +H+ FPS A +LP S + + +++ + Sbjct: 331 PAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKE 363 >AK124028-1|BAC85755.1| 160|Homo sapiens protein ( Homo sapiens cDNA FLJ42034 fis, clone SPLEN2038055. ). Length = 160 Score = 29.9 bits (64), Expect = 5.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 478 GKVEACDGNC*WRFPLGEPLWRLGGWCWRECR 383 G+ +C GN L EP WR W W+ CR Sbjct: 101 GRTSSCVGN------LSEPPWRPPKWLWQSCR 126 >AJ317973-1|CAC38071.3| 1044|Homo sapiens ataxin-2 related domain protein protein. Length = 1044 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +3 Query: 45 HPPRRHGGSPSGNRHQQ-FPSQASTLPISGKFQAH-DINNQQSQLVP 179 HPP+ HGG P G Q P+ +++ P + H + + SQ +P Sbjct: 992 HPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQVQSHPSQQLP 1038 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,789,632 Number of Sequences: 237096 Number of extensions: 1602629 Number of successful extensions: 3030 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3019 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5216942984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -