BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120069.Seq (764 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0986 + 25055674-25056571,25057741-25057782,25058651-25059888 29 3.1 09_04_0726 + 19758916-19759098,19759774-19760318,19760581-197614... 29 4.1 01_06_1415 + 37171380-37171923,37172476-37172666,37173628-37173678 29 4.1 12_02_0318 - 17457182-17462232,17462745-17462955,17463356-174634... 28 7.1 10_06_0007 + 9510385-9510535,9510860-9511433,9511553-9511565 28 7.1 04_01_0203 + 2432745-2433642,2433723-2433806,2434458-2434471 28 7.1 11_06_0634 - 25685216-25685329,25685407-25685511,25685681-256857... 28 9.4 11_02_0036 + 7599646-7599950,7600106-7600145,7600403-7600437,760... 28 9.4 07_03_0508 - 18892193-18893119,18893183-18894528,18894594-18895206 28 9.4 >12_02_0986 + 25055674-25056571,25057741-25057782,25058651-25059888 Length = 725 Score = 29.5 bits (63), Expect = 3.1 Identities = 9/34 (26%), Positives = 21/34 (61%) Frame = +1 Query: 658 YSLLNETFNNNVAPLLSSIYDEC*RAISSLKIWL 759 Y+++ ++FN+ + + S+ C R +S ++WL Sbjct: 92 YAVVGKSFNSTASTFVVSLLPSCNRTVSDARLWL 125 >09_04_0726 + 19758916-19759098,19759774-19760318,19760581-19761492, 19762067-19762328 Length = 633 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 547 CRLKTTMSIGRPFFTHLFSVIKN 479 C+LK + +PFFT LFS +KN Sbjct: 325 CQLKYSHDTNKPFFTALFSHMKN 347 >01_06_1415 + 37171380-37171923,37172476-37172666,37173628-37173678 Length = 261 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 341 KKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVKNTPELADFV 475 + I+ N Y+ +W T+ QP S W L K + A +V Sbjct: 133 RSSTISENSYLCVATWDTRAPQPSQIESAVRWALRKRSQNKAVYV 177 >12_02_0318 - 17457182-17462232,17462745-17462955,17463356-17463403, 17466161-17466346 Length = 1831 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +2 Query: 431 MWDLVKNTPELADFVFIFDHTEKMGKKWPTDRHRRLQATTQQFQRAKKDRLRCLPTQ 601 MW K+TP D F+ +K W T+ + L + + +DR+ LP Q Sbjct: 1544 MWQNSKSTPTPKDCAAFFEFVDK---NWNTEIGKYLAGSITKVPVCSEDRILLLPKQ 1597 >10_06_0007 + 9510385-9510535,9510860-9511433,9511553-9511565 Length = 245 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +2 Query: 248 NCFVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTK 397 N F+N L++ ++ + N M M+ + KRK+ + +L+ W K Sbjct: 15 NDFINTLDEVGLHNLDNAMEAMEVDLGTGKRKRYGEGESAKVLWEQWVEK 64 >04_01_0203 + 2432745-2433642,2433723-2433806,2434458-2434471 Length = 331 Score = 28.3 bits (60), Expect = 7.1 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 389 YTKIKQPEWPSSPAMWDLVKNTPELADFVFI-FDHTEK 499 + + +PEWPSS A+ N PEL V + D T K Sbjct: 169 HDQTNKPEWPSSVAVQHDQTNKPELPSSVAVQHDQTNK 206 >11_06_0634 - 25685216-25685329,25685407-25685511,25685681-25685740, 25685827-25685965,25686056-25686240,25686328-25686411, 25686499-25686621,25687088-25687267,25687364-25687433, 25687520-25687616,25687695-25687770,25688259-25688348, 25688383-25688529,25688647-25688715,25689004-25689177, 25689266-25689336,25689409-25689557,25690723-25690774, 25690865-25691120,25691196-25691287,25691420-25691541, 25691909-25692679,25692883-25692940,25693068-25693107, 25694462-25694595,25694685-25694793,25694896-25694991 Length = 1220 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -2 Query: 574 FFCSLELLRCRLKTTMSIGRPFFTHLFSVIKNEHK 470 FFCS +LLR + R L VI EHK Sbjct: 623 FFCSADLLRPDFSGGEEVERLAMAELIEVISEEHK 657 >11_02_0036 + 7599646-7599950,7600106-7600145,7600403-7600437, 7600789-7601189,7601281-7601361,7601451-7601536 Length = 315 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 505 THLFSVIKNEHKICQFGRVFHQIP 434 TH F +K E+ IC F R IP Sbjct: 198 THSFDAMKKEYYICGFARSIESIP 221 >07_03_0508 - 18892193-18893119,18893183-18894528,18894594-18895206 Length = 961 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +2 Query: 29 RCVFITNELPGCWALKKYIIKNTSGSFQRFTKIKHGKHAGATI 157 + FIT C+ + +KN +FQR T+I G G + Sbjct: 803 KTAFITRIGTYCYTTMPFGLKNAGPTFQRTTRISLGSQIGRNV 845 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,093,873 Number of Sequences: 37544 Number of extensions: 424999 Number of successful extensions: 1103 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1059 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -