BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120069.Seq (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) 31 1.3 SB_44509| Best HMM Match : EMI (HMM E-Value=4.2) 30 1.8 SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6) 30 1.8 SB_50241| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38410| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 4.1 SB_47960| Best HMM Match : Extensin_2 (HMM E-Value=0.54) 29 5.4 SB_14072| Best HMM Match : ELO (HMM E-Value=5.7) 29 5.4 SB_22629| Best HMM Match : CDC37 (HMM E-Value=3.7) 28 7.2 SB_57364| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) 28 7.2 SB_41377| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_10928| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 139 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 302 MPVMQDERKMSKRKKKVINNNKYILFNSWYTKIK 403 +PV +++ + K NN KY L WY+K++ Sbjct: 7 LPVQNQAKRLRTWRSKTRNNTKYKLICIWYSKVR 40 >SB_44509| Best HMM Match : EMI (HMM E-Value=4.2) Length = 782 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +1 Query: 10 DKCSKRK-VCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW*TCRSNNLLQKLRPCAK 186 D+ S RK C + +++ I+++ Q+ R +K+ K+ + TC +LR CA Sbjct: 63 DRYSTRKGACAVVQSSQKMIDIRRVRRQKSMRSCAKLSKDNRYSTCTPAEEYAQLRVCAV 122 Query: 187 MKS 195 ++S Sbjct: 123 VRS 125 >SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6) Length = 984 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +1 Query: 10 DKCSKRK-VCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW*TCRSNNLLQKLRPCAK 186 D+ S RK C + +++ I+++ Q+ R +K+ K+ + TC +LR CA Sbjct: 830 DRYSTRKGACAVVQSSQKMIDIRRVRRQKSMRSCAKLSKDNRYSTCTPAEEYAQLRVCAV 889 Query: 187 MKS 195 ++S Sbjct: 890 VRS 892 >SB_50241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Frame = +2 Query: 266 LEKKNINYILNVMPVMQDERKMSKRKKKVINNNKY---ILFNSWYTKIKQPEWPSSPAMW 436 +E K + Y V +DE K+ RK+ + +Y ILFN++ ++ +W S + W Sbjct: 26 IEAKTMKYKYGCSDVPRDE-KLDLRKRSLYYLERYFYFILFNTYLNMERRSKWDRSFSQW 84 >SB_38410| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 368 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = -2 Query: 388 PTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLFFQEIYK 254 P N+ +++ +L A + + HDR + E N+LF + +K Sbjct: 313 PREVHNILLLMGYLNSALNPYMYSFHDRQFKEAFKNILFNIQSHK 357 >SB_47960| Best HMM Match : Extensin_2 (HMM E-Value=0.54) Length = 710 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 215 RFQFIQQLFIFAHGRSFCRRLLLRHVYH 132 RF Q I+AH SF +R+LLR + H Sbjct: 22 RFPRNPQKLIYAHQNSFKKRILLRRIEH 49 >SB_14072| Best HMM Match : ELO (HMM E-Value=5.7) Length = 226 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = -2 Query: 370 VFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLFFQEIYKAISWSM 236 V ++ N L ++FV+ +HYV++ V LF E+ ++I ++ Sbjct: 108 VLVLYNLLCSVLSLYSFVIIAKHYVQNGVESLFRMEVNQSIKQAL 152 >SB_22629| Best HMM Match : CDC37 (HMM E-Value=3.7) Length = 504 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 505 THLFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVPT 383 TH SV+K K+C+ RV +Q H R R ++VPT Sbjct: 395 THWRSVVKKGAKLCEDKRV-NQAKHKRHLRKTRAASVTVPT 434 >SB_57364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 505 THLFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVPT 383 TH SV+K K+C+ RV +Q H R R ++VPT Sbjct: 240 THWRSVVKKGAKLCEDKRV-NQAKHKRHLRKTRAASVTVPT 279 >SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 505 THLFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVPT 383 TH SV+K K+C+ RV +Q H R R ++VPT Sbjct: 289 THWRSVVKKGAKLCEDKRV-NQAKHKRHLRKTRAASVTVPT 328 >SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) Length = 254 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 505 THLFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVPT 383 TH SV+K K+C+ RV +Q H R R ++VPT Sbjct: 198 THWRSVVKKGAKLCEDKRV-NQAKHKRHLRKTRAASVTVPT 237 >SB_41377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 331 Score = 27.9 bits (59), Expect = 9.5 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +2 Query: 83 IIKNTSG-SFQRFTKIKHGKHAGATIFYRNCGRVQK*KVVE*TGIELLQQIQHGPANCFV 259 I+K+T G F R K K + RNC +++ K +E + ++L +I GP + Sbjct: 148 IVKHTKGVCFSRRAKDSVKKES------RNCSSIEERKAIENSTVDLCPEISRGPCSTRP 201 Query: 260 NF 265 +F Sbjct: 202 DF 203 >SB_10928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 162 TETAAVCKNEKLLNKLESSSYNKSNMDQLIAL*ISWKKRTLTISST 299 T V N +LLN L S + + D+L L ++ + RT+++SST Sbjct: 191 TTPPLVTPNMELLNMLRVSLQPRLSEDELYELSLAREPRTMSLSST 236 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,959,464 Number of Sequences: 59808 Number of extensions: 523819 Number of successful extensions: 1312 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1311 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -