BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120069.Seq (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 24 1.3 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 4.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 4.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 4.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 4.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 4.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 4.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 4.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 4.1 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 7.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 9.5 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 9.5 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 620 SFNSAKFALVSTAVCLFLLAGIAALSLEDDDVDRSAI 510 S+NS FA++ T + +LE DD R+ I Sbjct: 206 SYNSDIFAMIGTIFLWLFWPSFNSAALEGDDQQRAII 242 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 93 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 218 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 93 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 218 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 93 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 218 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 93 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 218 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 93 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 218 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 93 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 218 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 93 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 218 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 93 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 218 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 7.2 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +2 Query: 254 FVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNN-KYILFNSWYTKIKQP 409 F+N +K N IL MP++ + K K K I+ K + N TK P Sbjct: 84 FINKNDKYEENTILTTMPLLINVVKYLGGKHKFISKKIKKTMENKDITKRPLP 136 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 144 PEQQSSTETAAVCKNEKLLNKLESS 218 P+ + + T+ K L NKLESS Sbjct: 85 PDSRDRSSTSNTSKTVILSNKLESS 109 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 144 PEQQSSTETAAVCKNEKLLNKLESS 218 P+ + + T+ K L NKLESS Sbjct: 85 PDSRDRSNTSNTSKTVILSNKLESS 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,732 Number of Sequences: 438 Number of extensions: 4664 Number of successful extensions: 20 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -