BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120068.Seq (804 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g23270.1 68416.m02933 regulator of chromosome condensation (R... 31 1.2 At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putativ... 30 2.1 At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ... 30 2.1 At2g36400.1 68415.m04467 expressed protein nearly identical to t... 29 4.8 At1g58025.1 68414.m06576 DNA-binding bromodomain-containing prot... 29 4.8 At1g02800.1 68414.m00237 endo-1,4-beta-glucanase / cellulase (CE... 29 4.8 At4g09150.1 68417.m01515 T-complex protein 11 contains Pfam PF05... 28 6.3 >At3g23270.1 68416.m02933 regulator of chromosome condensation (RCC1) family protein contains Pfam domain PF00415: Regulator of chromosome condensation (RCC1); similar to zinc finger protein (GI:15811367) [Arabidopsis thaliana]; similar to chromosome condensation regulator protein (GI:22770461) [Cicer arietinum] Length = 1045 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 424 QAEQLIFHLIYNNEE-AVNVICDNLKYTEVSQAARNGYTQRLRNYKKHS 567 + + L F L+YNN E ++++IC + TEV AA ++ RN + S Sbjct: 82 EKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIEKSRNRRARS 130 >At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 361 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 364 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 486 R ++ + T+Y + FNL S A + + HLI + +E + V+C Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186 >At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 494 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 364 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 486 R ++ + T+Y + FNL S A + + HLI + +E + V+C Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186 >At2g36400.1 68415.m04467 expressed protein nearly identical to transcription activator GRL3 [Arabidopsis thaliana] GI:21539884 (unpublished); supporting cDNA gi|21539883|gb|AY102636.1| Length = 398 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/64 (29%), Positives = 26/64 (40%) Frame = +2 Query: 35 RDFFLNHKIAVVHIYNGNNMALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAY 214 RD F HK H++ G N + PV P + AS V+ A T + S A+ Sbjct: 162 RDVFAGHKYCERHMHRGRNRSRKPV-ETPTTVNATATSMASSVAAAATTTTATTTSTFAF 220 Query: 215 HDDG 226 G Sbjct: 221 GGGG 224 >At1g58025.1 68414.m06576 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487; contains prenyl group binding site (CAAX box) Prosite:PS00294 Length = 769 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 499 YTEVSQA--ARNG--YTQRLRNYKKHSRHHKPEHVLFACVARR 615 YTE S A +G + + +++K+H RHHK + + CV +R Sbjct: 320 YTEQSAAENTEDGGKASTKQKSHKRHGRHHKSDCMCAICVLKR 362 >At1g02800.1 68414.m00237 endo-1,4-beta-glucanase / cellulase (CEL2) identical to endo-1,4-beta glucanase; ATCEL2 GI:3132891 from [Arabidopsis thaliana] Length = 501 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +1 Query: 526 NGYTQRLRNYKKHSRHHKPEHVLFACVARRIAFF---RRDQRPNASRWCWRS 672 NG++ H RHH H +++ I FF R + P R WRS Sbjct: 22 NGFSSSSSRPSIHHRHHLDNHNYKDALSKSILFFEGQRSGKLPPNQRMTWRS 73 >At4g09150.1 68417.m01515 T-complex protein 11 contains Pfam PF05794: T-complex protein 11 Length = 1097 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/54 (35%), Positives = 23/54 (42%) Frame = +1 Query: 496 KYTEVSQAARNGYTQRLRNYKKHSRHHKPEHVLFACVARRIAFFRRDQRPNASR 657 K E QAA+NG QR+ + E VL A R + F QR A R Sbjct: 115 KMDEARQAAKNGLEQRVEKERDELESKVEERVLKAEKNRMLLFKAMAQRRAAKR 168 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,020,422 Number of Sequences: 28952 Number of extensions: 345659 Number of successful extensions: 812 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -