BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120066.Seq (806 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 22 5.0 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 5.0 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 22 5.0 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 8.7 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 411 SVDGAQQHPLVFCKQNG 361 +VDG Q+HPL NG Sbjct: 146 NVDGCQKHPLCNDDPNG 162 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -3 Query: 390 HPLVFCKQNGFSGNACVISFSDHKL 316 HP V G+SG+ C F+ + Sbjct: 119 HPQVLLSPGGYSGSLCDQGFAQQPM 143 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +3 Query: 720 RFLPTNCDRQ 749 RFLP NCD++ Sbjct: 111 RFLPENCDKR 120 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +1 Query: 286 PLVTNFTNKMEFVVTETNDTSIPGEPILFTE 378 P++ +T + +V T PG P F E Sbjct: 300 PMIFGYTTREGMIVEMMRKTETPGMPNDFEE 330 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,979 Number of Sequences: 336 Number of extensions: 3753 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -