BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120065.Seq (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 2.0 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 3.5 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 570 ILFHCATLVTLHLITSTTFRLCCKR*NANFQP 475 +LFH + H++ ST LCC + P Sbjct: 1345 MLFHRFGTIA-HILASTELNLCCTKKKEELSP 1375 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 570 ILFHCATLVTLHLITSTTFRLCCKR*NANFQP 475 +LFH + H++ ST LCC + P Sbjct: 1345 MLFHRFGTIA-HILASTELNLCCTKKKEELSP 1375 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 570 ILFHCATLVTLHLITSTTFRLCCKR*NANFQP 475 +LFH + H++ ST LCC + P Sbjct: 1345 MLFHRFGTIA-HILASTELNLCCTKKKEELSP 1375 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 570 ILFHCATLVTLHLITSTTFRLCCKR*NANFQP 475 +LFH + H++ ST LCC + P Sbjct: 1345 MLFHRFGTIA-HILASTELNLCCTKKKEELSP 1375 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 12 KSQPNRLQIRNVLKFEGDTRELDRTLSGYE 101 KS + I N + GDT E+ +L GY+ Sbjct: 215 KSVEELMNIANYYRILGDTVEIFNSLFGYQ 244 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 515 NVVDVIKCSVTSVAQWNKINDNFDA 589 N++ VIK S + W + +FDA Sbjct: 486 NLLSVIKSSFLDINTWKMLVKSFDA 510 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = +2 Query: 488 AFQRLQHNRNVVDVIKCSVTSVAQWNKINDNFDAASLASVLFEKSL 625 A++ Q R + V VTS W +ND+++ L ++ L Sbjct: 240 AYRFGQITRRIAAVASEKVTSEKSWIALNDDYNRLCHLCFLLDEKL 285 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,398 Number of Sequences: 336 Number of extensions: 3375 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -