BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120064.Seq (451 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22729| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_11179| Best HMM Match : ERM (HMM E-Value=4) 27 7.2 >SB_22729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 403 TNHVYLLIPGNTMFVTRSCNCQQSHER 323 +N V LLIPG+++ S NC++ H++ Sbjct: 17 SNQVKLLIPGSSVCPLNSLNCKEKHKQ 43 >SB_11179| Best HMM Match : ERM (HMM E-Value=4) Length = 407 Score = 27.1 bits (57), Expect = 7.2 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +1 Query: 319 YLSHVTVDNYKSESQTLYCQESVNKHGLYIP 411 ++++V V +YK + Q L C++ G+ +P Sbjct: 23 FMAYVRVADYKKQPQALSCKDKKLSQGMLLP 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,935,057 Number of Sequences: 59808 Number of extensions: 204760 Number of successful extensions: 369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -